SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378951813|ref|YP_005209301.1| from Pseudomonas fluorescens F113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378951813|ref|YP_005209301.1|
Domain Number 1 Region: 7-179
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.24e-33
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378951813|ref|YP_005209301.1|
Sequence length 182
Comment cytochrome b561 [Pseudomonas fluorescens F113]
Sequence
MPWKSSESRYSTVTVTLHWLMLVLLAVVYACIEFRGIFPKGSGGRTLIKEAHFMLGLTVF
LLVWLRLFARSMGKTPAIFPASPVWQTVLARLMHWALYLFMIAMPLLGWLITSAEGHQVM
FYGFDLPLLIDQDKEFAKQLEGWHVLGGTIGYWLIGLHALAGLYHHYVVRDNTLLRMMPK
RG
Download sequence
Identical sequences A0A0F4XIL2 A0A1V3RYE2 A0A1V4F800 G8PXU7
gi|378951813|ref|YP_005209301.1| WP_014339294.1.10399 WP_014339294.1.16422 WP_014339294.1.22661 WP_014339294.1.39650 WP_014339294.1.47548 WP_014339294.1.66223 WP_014339294.1.93422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]