SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378952697|ref|YP_005210185.1| from Pseudomonas fluorescens F113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378952697|ref|YP_005210185.1|
Domain Number 1 Region: 6-278
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 8.48e-95
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000417
Further Details:      
 
Domain Number 2 Region: 281-396
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 2.62e-33
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000576
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378952697|ref|YP_005210185.1|
Sequence length 403
Comment Ubiquinol--cytochrome c reductase, cytochrome B subunit [Pseudomonas fluorescens F113]
Sequence
MSKFMDWVDARFPATKMWEDHLSKYYAPKNFNFFYFFGSLALLVLVNQIVTGVWLTMSYT
PSAEEAFASVEYIMRDVEYGSILRLLHSTGASAFFIVVYLHMFRGLLYGSYQKPRELVWV
FGMLIYLALMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVIGDDLTQWIRGDYLISGIT
LNRFFALHVVALPIVILGLVVLHILALHEVGSNNPDGVDIKKHKDENGIPLDGIAFHPYY
TVKDIVGVVVFLFIFCSIVFFFPEMGGYFLEKPNFEQANAFKTPEHIAPVWYFTPFYAIL
RAIPDKLLGVIAMGAAIAVLFVLPWLDRSPVKSMRYKGWLSKIWLVVFCISFVILGVLGV
LAPTPGRTLLSQVCTFLYFAYFILMPFYTRLEKTKPVPERVTG
Download sequence
Identical sequences A0A1H5DB40 A0A1V3S2M7 G8QAV0
WP_014340078.1.10399 WP_014340078.1.14316 WP_014340078.1.16422 WP_014340078.1.39650 WP_014340078.1.61085 WP_014340078.1.66223 WP_014340078.1.93422 gi|378952697|ref|YP_005210185.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]