SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378953292|ref|YP_005210780.1| from Pseudomonas fluorescens F113

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|378953292|ref|YP_005210780.1|
Domain Number - Region: 151-212
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.1
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378953292|ref|YP_005210780.1|
Sequence length 376
Comment putative iron-regulated membrane protein [Pseudomonas fluorescens F113]
Sequence
MKSKTIRRWSFVHTWTSLICTVFLLMLAITGLPLIFHHEIEHLLGDAPQLREMPADTPPL
DLQQLVEKAKAHRPGEVVQYFGWDDDDPNGVITIMAPTPGTEPNSSHTFMLDGRTGEALE
MPSANGGFMMVMLRLHVDMFAGLPGKLLLAFMGLLFVIAIVSGVVLYLPFMRRLKFATVR
QDKSTRLRWLDLHNLIGVVTLVWALTVGVTGVIAACADLIIAAWRNDSLSAMVEPYRNAP
PLTQLAPATRLLDIAKDVAPGMEPSFIAFPGTLFSSEHHYSVFMKGDTHLTSHLLTPVLI
DATTLDVTAVAERPWYMDVMSLSLPLHFGDYGGRPMQIFWATLDVLTIIVLGSGVYLWLV
RRKAAKRATVGTEVTS
Download sequence
Identical sequences G8Q1E6
gi|378953292|ref|YP_005210780.1| WP_014340562.1.39650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]