SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378953386|ref|YP_005210874.1| from Pseudomonas fluorescens F113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378953386|ref|YP_005210874.1|
Domain Number 1 Region: 5-180
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.49e-39
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378953386|ref|YP_005210874.1|
Sequence length 183
Comment protein CybB [Pseudomonas fluorescens F113]
Sequence
MQLRNSSSRYGWVSIAVHWGVALAVYGLFALGLWMVGLDYYSTWRKDAPDLHKSIGLVLL
AVMLLRVIWRVVSPPPPTLETYGRLTRVGAKLGHSALYLGLFAVMIAGYLISTADGVGIP
VFGLFEVPALVSGLPDQADVAGQIHFYLAWALVIFSGLHALAALKHHFIDRDATLKRMLG
RQA
Download sequence
Identical sequences A0A0F4XQL0 G8Q2K9
WP_014340646.1.22661 WP_014340646.1.39650 gi|378953386|ref|YP_005210874.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]