SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378953531|ref|YP_005211019.1| from Pseudomonas fluorescens F113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378953531|ref|YP_005211019.1|
Domain Number 1 Region: 91-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000314
Family NfeD domain-like 0.0034
Further Details:      
 
Weak hits

Sequence:  gi|378953531|ref|YP_005211019.1|
Domain Number - Region: 32-77
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0366
Family Glycerol-3-phosphate transporter 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378953531|ref|YP_005211019.1|
Sequence length 164
Comment hypothetical protein PSF113_5652 [Pseudomonas fluorescens F113]
Sequence
MWVFLQNMSYWDWLALGVILLILEVFGAGGYLLWIGMAAAAVGVLTFILPQMPWELQFLL
FGLFAIATALYWWQRQRSAVRESDQPHLNLRGQELIGKVFQVHEAIVDGRGKIKVADSVW
LAKGPESSVGTRVRVVAQDGAVLQVERADREVMELNGGAGNPTS
Download sequence
Identical sequences G8Q4U1
gi|378953531|ref|YP_005211019.1| WP_014340769.1.39650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]