SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378950979|ref|YP_005208467.1| from Pseudomonas fluorescens F113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378950979|ref|YP_005208467.1|
Domain Number 1 Region: 436-576
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.1e-35
Family Flavohemoglobin, C-terminal domain 0.002
Further Details:      
 
Domain Number 2 Region: 331-431
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 5.79e-25
Family Ferredoxin reductase FAD-binding domain-like 0.0017
Further Details:      
 
Domain Number 3 Region: 564-680
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.82e-21
Family 2Fe-2S ferredoxin-related 0.015
Further Details:      
 
Domain Number 4 Region: 177-290
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.00000000105
Family PNP-oxidase like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378950979|ref|YP_005208467.1|
Sequence length 684
Comment pyridoxamine 5 -phosphate oxidase-related fmn-binding protein [Pseudomonas fluorescens F113]
Sequence
MDEALQAKNSPWHEGELTLQRSVGAVDMMASVGQRQLARTWMPDQHREFYAQLPFVVLGA
VDRQGDVWATLRAGQPGFMNSPDPQTLHIQLEPEPNDPAQEGMGEGDAIGMLGIELHTRR
RNRMNGVVRRQLGPGLEISVSQAYGNCPRYINLRQYHFVDAQAVAPRQLTVADPLVRRLV
TAADSFYIATYVVRDGERQVDASHRGGKPGFVRMDEDGSLTIPDFSGNLFFNTLGNILLN
PRAGLVFVDFQTGDLLQMSGSAQVLLDDPEISAFQGAERLLRFTPQRIVYRPAAIALRWK
DQDEGDSPNSMMTGSWEQAAERLQAEALRSRWRALRVARVVDESHNIRSFYLQASDGLGL
PRFEAGQHLPVRILLEGQNAPSIRTYSVSSAPSDDFLRISVKRDGSVSSHLHDQVQAQHE
IEARAPQGHFTVQATERRPLVLLAAGVGITPLLSMLREVVYQGQRISRMRPVWLVQSARS
VADLAFRDEIDELAARAGDKLQVLRMVSQPPTEAGGAEGYDLAGRIDVELLKKLLPLNDY
DFYLCGPGSFTQALYDGLRKLRIPDDRIHAETFGPSTLVRDLEVSVPAPEQVPAASEAVK
VLFTSSGKEARWEPGSGTLLELAEARGLNPEFSCRGGSCGTCKTRLSRGQVHYLSQPAEP
VGEGEVLICCAVPAQGSEPLVLEV
Download sequence
Identical sequences G8Q4B9
gi|378950979|ref|YP_005208467.1| WP_014338512.1.39650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]