SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378952264|ref|YP_005209752.1| from Pseudomonas fluorescens F113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378952264|ref|YP_005209752.1|
Domain Number 1 Region: 664-940
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0000000379
Family Tricorn protease N-terminal domain 0.022
Further Details:      
 
Weak hits

Sequence:  gi|378952264|ref|YP_005209752.1|
Domain Number - Region: 936-1023,1093-1177
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0262
Family Tricorn protease N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378952264|ref|YP_005209752.1|
Sequence length 1594
Comment Rhs family protein [Pseudomonas fluorescens F113]
Sequence
MDQVSRIEQELDSFKGTLSFYREQLERWYSRAADRASHAADLPSLMGMERLIRFGDSTTA
VSTGDDDFLSTVVQCPKGGPMTIESKFESVYDIPLGDIVVDVVDVASGEVTPVTLDAQGL
GTFTGEAGKSYRVHVQGGVSAKQIASLFSSYDGLTTDLTDWLRGEWQGFKPRWAQQSLST
SAAAVGNGLLAGSWAAIESVWDSISLLSEILKDPGQFVERLGDSADQLKTLARDAPLVMA
KLQLLASDEAALCMLVRTASLWLEMLPPSEVAGETARGLSTVAVQLVIDLLIGVVLTFAG
AGVGIAYLSMRLARHSATLLNAMQRFILAIFAVVNGFMTYVDRYKTVAARGIATGIKKGR
MQLRWDAQRNTTLKRHEPHDDAPTQSKNPNGDPADTASQTQTSGCPVSMVTGEELLTLDD
GTLDGRLPFVFTRLYRTSAADLDVGLGRGWSHALAHRLELDGEQVTWVDQENRRTTFPLP
SAQRPAIHNSLARAAIYLGTEADELIVAQPGENAPFLHFRDGHLVALSDRYDNRLTLQRN
IHGDICRLDNGAGRALRLRYEQRHLIAVDYQSFHPAITLDEAWRTEQTLVSYRYDGRFRL
IEATNAAGESERYDYDDQHVILQRQLAGGASFYWEWQGLGPASRCVRHWASFAQMDSRYT
WGEDGSVTVRHLDGSQEVYVHDDRARLVRKVEPDGGEHLKAYDEQGRLIAEQDPLGTVTE
YRYDDVGRLVALLPPDETPTSYEYRNGFLHTRSRGKAVWSYRRNARGDVIVLIDPDGRRT
EYAYDVHGQLLATYDPDGAEHRFTWSRLGQLTEEILPDGSRRCFSYDALGRLLSRQDEHG
ALTHYQWDAVGRLLQVTLPNGATRIWRYNAYGKVTAECDEQGRVTRYEYADDLHLVSRRL
NPDGSELKYRYDSARLLLTEIENESGEKYQLDYTPNGLIRQQVGFDGQRTAYAYDLNGHL
LEKTEHGEDGSQRLTQYQRDAAGRLRVKTLPDGQAIEYRYDELGRLVHVNDGSNHPLAFE
YDAQDRLVCEHQGWGTLRYRYDACGRLNHLRLPDDSQLDYHHAPGGALTAIDLNGSRLTE
HRFVGGRERQRQQGRLLSDYTYDEQGRLKAQTVWQNQQQQLFWRDYAYSAKGNLQTLSDN
RNRRSYQYDPLDRLTRIDFSHSEPPEHFCHDPAGNLMMQDRPGPTTLKGNRLLKEGDRHY
DYDAFGNLIRERRGQALVSAYRYDSQHRLIGVTTADGRETSYRYDAFGRCISKTVDGLTT
EFFWQGDQVVAENSPRHHRSYVYEPGTFRPLAMLDGEGPEKATPFYYHLDHLGTPQELTS
HSGQIVWSARYSGYGQLTELQHGGGEQLEQPLRFQGQYFDPESGLHYNRHRYYNPETGRY
LTPDPSKLAGGLNGYRYTLNPTGWVDPLGLVDCPGKGGCRPAVGEQDPAVKVGVDEGEPR
LPMTAEQRAQEHELAEAKAYKELREMEGSIDGAHFLEKHGAQTTLQSQMERLQSGKNPTT
GEIERYTKGKKKGEPKIPTAATHFISHRDQLYAINRARLVFKESGLQQSREPIEFGRKVG
EGYKKEGLEYGEQTKAVVILNDKGLPITSYTEFE
Download sequence
Identical sequences G8Q4K2
WP_014339700.1.39650 gi|378952264|ref|YP_005209752.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]