SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378953692|ref|YP_005211180.1| from Pseudomonas fluorescens F113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378953692|ref|YP_005211180.1|
Domain Number 1 Region: 668-833,886-932,965-988
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0000334
Family Tricorn protease N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378953692|ref|YP_005211180.1|
Sequence length 1472
Comment Rhs-family protein [Pseudomonas fluorescens F113]
Sequence
MSDALWAARLGDALNHTSMMADILGGVLEVAANIAITALATAAVVAATGITVVTGGLGCF
VLGLVVGTIVGLAMSKTGADKGLSNLCEGIGNALFPPTVQANILTGSKDTFTNNIPSARA
AGAVVSHVAPAGTELEMPEPEEEPSYLDMAGNFFSQMWRPTVASPAPGTETRPEDLVICT
KHPPMPPQFMAEGSDKVTINGQPAVRSGDRSTCDATVVSAGLISPDVTIGGGSVVVREIR
SGKTPGVGLAVTALLMLKGGKGKFFSKLPCMLVGGAVSMAASSAANAAANAAMGSSNPVH
AATGAKVLGGDEELDFVLPGILPIDWQRVYNSRDERHDSLFGAGWSVAYEVQVQILPHPD
GGETLVYTDEQGRPIDMGSIPLGGAVFSAGEGLAVRRHVNGQLLIESDDGLYRLFEPSPA
NPSHLRLSQLGDRNDNRIHLDYDDAGRLVRLRDTFDLVQVELIRAGERVTHIERLYPDQS
REVLVSYAYDAANTLAEVRDATGQVQRRFSYDAGQRMVEHQLPSGLHCFYEWALIDDQEW
RVVRHWTDEGDAYQFDYDLKAGITRISDSLQRVSTRHWNSQHQITQFTDNLGQTWLFEWN
DERQLLSATDPQGGQYTFSYDDAGNLLSETDPLGRSESTLWLEHWALPLVDTDAAGHSWK
YRYDQRGNCTVETDPLGHITRYRYDTHGQVVEIIDATGKSKKLRWNPFGQLVEHVDCSGY
PTRFSYDARGYLQTITDALGERTQFSYDAQGRLLSSQLPDGRTEHYQRDTAGHLIGYTDP
AGHTTLYQHNRRGQVRQRTDAQGRQVQFAYDSFGRLQALTNENGESYRFAWDIGDRLTEQ
QDLDGSAKRYDYDRLDNVAAVTAMPAPYGTGLALIPETPPAPIVHRLERDAVGRLIAKVT
DDGRTEYSYDPLDQLTAVTFTDLQGNAQTLSFAYDALGQLLAENSGAGSLQHHYDELGNL
IQTQLPDGRWVNRLYYGSGHLHQINLDGQVISDFERDRLHREVLRTQGQINTRSEYDRSG
RLRARQRRHSSQPSLLPAAVQKHFEYDPADNLIGKLDQQPAAQQRQLLHYDATGRIIASQ
DSLHGQRETFTYDAAANLLDGPAPGAGLVVHNKLLTYQDKRYRYDAFGRMIEKRSAKRGV
QHFAYDAESRLIEVRNDNGSVVKMAYDPLGRRIEKTEHDSNGYPLGETRFTWDGMRLLQE
SRYNQTSLYLYTDNTYEPLARIDGYGAHQKVRYYHNDLNGLPEQLTEADGRSVWQARFEV
WGNPLQEIREPYFIEEQNLRFQGQYLDREIGLHYNVLRFYDPDVGRFTTPDPIGLAGGLN
FYAYAPNPIGYADPLGLAVDPLIKLKDRGYTGVTKTPGGGLDYSESNALYNKKPGVNPIV
RIEYTGDYGKDFEAANKAANLSQKTTPSGHVWHHLDDYDPKTNTGTMQLIKQNAHNGISH
NGGVAQYKAATGKAYTHPARFKSRTKGASKCG
Download sequence
Identical sequences G8Q729
WP_014340894.1.39650 gi|378953692|ref|YP_005211180.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]