SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334319728|ref|YP_004556357.1| from Sinorhizobium meliloti AK83

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334319728|ref|YP_004556357.1|
Domain Number 1 Region: 83-152
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 1.44e-30
Family CO dehydrogenase ISP C-domain like 0.00033
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.98e-25
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|334319728|ref|YP_004556357.1|
Sequence length 165
Comment Isoquinoline 1-oxidoreductase [Sinorhizobium meliloti AK83]
Sequence
MISLTVNGSPHQIDADPATPLLYVLRDELALNGAKYGCGLGQCGSCTVVVDGEAVLSCMV
PIMLLEGREITTIEGLGTIDEPGPLQEAFIELQAAQCGYCIPGMMMSAHALLRRNAQPSE
EEIREALATNLCRCGTHMRILAAIRRAGELMRAASLPATDQGRAG
Download sequence
Identical sequences A0A0E0UPP2 A0A222IZ78 Q92WF1
266834.SM_b20403 gi|16264137|ref|NP_436929.1|NC_003078 gi|384533711|ref|YP_005716375.1|NC_017323 gi|407723890|ref|YP_006843551.1|NC_018701 gi|334319728|ref|YP_004556357.1| gi|384533711|ref|YP_005716375.1| gi|407723890|ref|YP_006843551.1| NP_436929.1.96377 WP_010975277.1.18618 WP_010975277.1.22199 WP_010975277.1.30341 WP_010975277.1.3038 WP_010975277.1.3110 WP_010975277.1.34728 WP_010975277.1.36292 WP_010975277.1.36834 WP_010975277.1.4234 WP_010975277.1.44594 WP_010975277.1.49828 WP_010975277.1.58221 WP_010975277.1.58608 WP_010975277.1.787 WP_010975277.1.90968 WP_010975277.1.94084 WP_010975277.1.96031 WP_010975277.1.99158 gi|16264137|ref|NP_436929.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]