SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|395443789|ref|YP_006384042.1| from Pseudomonas putida ND6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|395443789|ref|YP_006384042.1|
Domain Number 1 Region: 374-576
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 3.14e-26
Family Creatinase/aminopeptidase 0.0029
Further Details:      
 
Domain Number 2 Region: 226-346
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.57e-23
Family Reductases 0.0086
Further Details:      
 
Domain Number 3 Region: 30-119
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 7.87e-22
Family 2Fe-2S ferredoxin-related 0.056
Further Details:      
 
Domain Number 4 Region: 130-223
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.33e-20
Family Ferredoxin reductase FAD-binding domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|395443789|ref|YP_006384042.1|
Sequence length 588
Comment iron-sulfur cluster-binding protein [Pseudomonas putida ND6]
Sequence
MKYPKLEVLLVLDYSNNRTSICPEVLMQSRHVIEISPTGKTFEASQELLLDAMLASGLPV
PFSCRRGACGSCKVKVVSGQHQDKQRDADTPPPSYPLADDEMLLCQSHACSDMRLEIPGW
SLDAPALETQAQVVGKRALSADIVELVLQPAQPLEVRAGQYMRFQLDNGDSRCFSIANLP
AQEQGQLVFHIRKVSGGLFTEGLLPTLQAGATVKLEGPLGACTWQHDDQRPLILFATGTG
YAGIKPLLLTALAGNADVTLYWGGSSPADFYDREFLDVSSRVHPHFRWQPVLSAQARIQQ
VALSQTHRWGETQVYACGNATMISQAREQCLAAGVQPHRFVAEAFVASGALTTQASSTNP
LHPELEKVGPRYSLDGMLAAREQSVRAVAAIASQLQVGMTTAQALEMAAHTLQAMGASHT
WHPTYIRFGDDTVRTPRQGIDLQRVLRTTDIVVVDVGPVWDGYEGDYGDTFVFGQHALHH
ACVKALHEVFDETRQAWGRGLTGRELYDFAERSAQAKGWQLERNLAGHRIADFPHVLYSQ
DKLAEVEIVPSEVVWVLEIQLCHPTEPVGAFFEDILIGERKPGAARAA
Download sequence
Identical sequences I3UN56
WP_014753455.1.100978 WP_014753455.1.74642 gi|395443789|ref|YP_006384042.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]