SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|319891602|ref|YP_004148477.1| from Staphylococcus pseudintermedius HKU10-03

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|319891602|ref|YP_004148477.1|
Domain Number - Region: 30-117
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 0.00687
Family ATP synthase (F1-ATPase), gamma subunit 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319891602|ref|YP_004148477.1|
Sequence length 167
Comment hypothetical protein SPSINT_0312 [Staphylococcus pseudintermedius HKU10-03]
Sequence
MKKLVSAMLITGLTFSGIYAGTADAMSGNTLESVKSLQHGDRTVEGVTIGERMSDVFRDK
GHGIHTKEAYGHHHYYEIHTKDGVMIVTASGAGRHAKVTRVSMIYNKLNGPKYQEVKDQV
SARAIKREHHNHVTGGSGYISDGKVAYQFATSTPKNQTLKLYRIDVE
Download sequence
Identical sequences A0A161WGN8
WP_014614659.1.17323 WP_014614659.1.31200 WP_014614659.1.34305 WP_014614659.1.53836 WP_014614659.1.59480 WP_014614659.1.74935 WP_014614659.1.78246 gi|319891602|ref|YP_004148477.1| gi|386320060|ref|YP_006016223.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]