SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386328397|ref|YP_006024567.1| from Serratia sp. AS13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386328397|ref|YP_006024567.1|
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 4.18e-29
Family MOSC N-terminal domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 284-366
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.44e-21
Family 2Fe-2S ferredoxin-related 0.012
Further Details:      
 
Domain Number 3 Region: 3-50,147-263
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.00000000000000115
Family MOSC (MOCO sulphurase C-terminal) domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386328397|ref|YP_006024567.1|
Sequence length 367
Comment MOSC domain-containing protein [Serratia sp. AS13]
Sequence
MITLSRLYVHPVKSLRGLQLSHAQVSSSGLAFDRTFMITEPDGTFITARQYPQMVLFTPA
LLADGLFLTAPDGESAAIRFADFAAEAQPTEVWGNHFTALIAPPAINSWLSGYFQREVQL
RWLGPDLTRRVKKHPEIPLSFADGYPYLLINEASFNDLQQRCPGSIKLEQFRPNLVVTGA
SAWAEDGWQVIRVGDVMFDLVKPCSRCVLTTVSTERGRKHPSGEPLSTLQKFRTADNGDI
DFGQNMVARNSGIIRVGDAVEVLSTKPPRPYGAGKVVESMQAPQDSAQSVTIEYAGKVFT
GNNQQILLEQLEQQGIRVPYSCRAGICGSCRIELVSGEVAPLKKSAVAGNGTILSCSCIP
KSDLTLA
Download sequence
Identical sequences gi|386328397|ref|YP_006024567.1| gi|333931527|ref|YP_004505105.1| WP_013812323.1.100617 WP_013812323.1.28294 WP_013812323.1.87098 gi|333926574|ref|YP_004500153.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]