SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317120982|ref|YP_004100985.1| from Thermaerobacter marianensis DSM 12885

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317120982|ref|YP_004100985.1|
Domain Number 1 Region: 16-235
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.79e-55
Family PP-loop ATPase 0.00013
Further Details:      
 
Domain Number 2 Region: 217-245,272-345
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00000497
Family MesJ substrate recognition domain-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317120982|ref|YP_004100985.1|
Sequence length 668
Comment tRNA(Ile)-lysidine synthetase [Thermaerobacter marianensis DSM 12885]
Sequence
MDEPGNLEAEVEAFARQHRLLRPGHRVLVAVSGGRDSTVLLDLLHRLQERLGLAALGVAH
VDHGLRPGSADDARWVAEQAAARGLPFLLRRVCVERGRRSLEDAARAARYRALREMAGEF
GAHRVALAHHAGDQAETVLMRLVAGAGVRGLAGMRPRRGPFVRPLLAVTPARLAAYAAAR
GLTWRDDPTNRDLRILRNRVRHRLLPLLEAEFNLRTVETLARVATLLAAEADLLDRRTRR
LEARLGTAVVPAVPVDGQAAGAGATTAGGGTVAAWACRVADLARLAVADQRRLLQAAFFR
RAGRPLPWARCEAVRTLVRQAALGGTGGRVDLPGGWRARCDGAWLWLEPAEGAAGRPRRL
RRQAPVGATRRGTSPAGATAPGEPGTCREEPAPLVLPVPGAVPLGCGLWLRARWLHGTAA
RQAAAALDEARTPSPVSPTRIPGRDDPRVGARFAFRALIGQRALDEAAAAEDCASVTGAG
RDAAGGGAAPPRPGHPVGTGDGDGTGAAGRAAGETAGAPRPGTQWVLVVRPPRPGETLQA
LGSRGQRPVERLYRAAVRRGDLYVIDPRTGTGGVLPPRAVAVAADAGGGAGPGSGGAGRE
RILWLAGVRTAAACRVLPDEEAVLCLEVTARPPREPGGDAAAAGSAGGAACRRGHEEGDR
RSGPARHP
Download sequence
Identical sequences E6SL56
WP_013494563.1.7975 gi|317120982|ref|YP_004100985.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]