SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317122014|ref|YP_004102017.1| from Thermaerobacter marianensis DSM 12885

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|317122014|ref|YP_004102017.1|
Domain Number - Region: 98-167
Classification Level Classification E-value
Superfamily FlgN-like 0.00392
Family FlgN-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317122014|ref|YP_004102017.1|
Sequence length 207
Comment hypothetical protein [Thermaerobacter marianensis DSM 12885]
Sequence
MSKVQAGSPARFLVFLVVVAVVFAYIAAKWDDFNHQSALYDGSTGTVGFDQQGTGTAGPE
GTGADMGTLPGGTAAGEAGWAALEGTAPGAEAGSFAELRVQRTAIYDRQVEQLQAIASDP
NASASAREQAQQALVQLTQRQGVEQQIEQLIRSKGYEDAVVFVYDQAAIVVVKADRFAQA
DAARIADIVRQVTGIGYEGIRIVTRNS
Download sequence
Identical sequences E6SL59
WP_013495595.1.7975 gi|317122014|ref|YP_004102017.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]