SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317122029|ref|YP_004102032.1| from Thermaerobacter marianensis DSM 12885

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317122029|ref|YP_004102032.1|
Domain Number 1 Region: 10-285
Classification Level Classification E-value
Superfamily Folate-binding domain 5.16e-105
Family Aminomethyltransferase folate-binding domain 0.000000305
Further Details:      
 
Domain Number 2 Region: 278-369
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 5.89e-26
Family Aminomethyltransferase beta-barrel domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317122029|ref|YP_004102032.1|
Sequence length 372
Comment aminomethyltransferase [Thermaerobacter marianensis DSM 12885]
Sequence
MTGETTQGESLRRTPLYEEHKALGARMVPFAGWEMPLQYTGIVEEHRAVRQAAGLFDVSH
MGEIEVSGPGARQALQRLVTNDVERLVPGRALYTVMCTPEGGVVDDLLVYQLDDQRYMLV
VNAANTARDLEWVREHAGGPQVTVVDRSLETALLALQGPRAQAILSLVTDDVDLEALRPF
HFVGGWEGMISRTGYTGEDGFELFVSWDGAPAIWRGILAAGEPEGLVPAGLGARDTLRLE
ACLPLYGQELDLETTPLEAGLDFVVKWDKGPFLGRDALLRQRQQGLRKKLVGLRLLEPGV
ARTGYRVLDERGEPVGRVTSGTVAPTLQASIALAYVPPAVAAVGQRLAVEIRGRAVAAQV
VETPFYRRRRGG
Download sequence
Identical sequences E6SL74
WP_013495610.1.7975 gi|317122029|ref|YP_004102032.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]