SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317122474|ref|YP_004102477.1| from Thermaerobacter marianensis DSM 12885

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317122474|ref|YP_004102477.1|
Domain Number 1 Region: 11-332
Classification Level Classification E-value
Superfamily DAK1/DegV-like 3.4e-128
Family DAK1 0.00000000918
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317122474|ref|YP_004102477.1|
Sequence length 333
Comment dihydroxyacetone kinase DhaK subunit [Thermaerobacter marianensis DSM 12885]
Sequence
MKKLINRVEAVVDEATEGLGLAHPDLVRVHAEPRYVARADAPVQGKVALISGGGSGHEPL
HGGYVGRGMLDAACPGEVFTSPVPEQMVEAAKAVHGGAGVLFIVKNYTGDVMNFELAAEL
LQAEGIDVRSVLVADDVAVENSLYTAGRRGVGGTVFVEKIAGAAAEAGASLDEVERIARK
VSDNVRSMGMALTSCTVPAKGSPTFELGEDEMEIGIGIHGEPGRERMKLRPADEITEMLA
GPVIEDLGLKGGEQVIAMVNGMGGTPLMELYIVYRKLAAILREKGITVARNLVGNYITSL
EMQGCSITLLRADDELLRLWDAPVHTPALRWGA
Download sequence
Identical sequences E6SH86
WP_013496051.1.7975 gi|317122474|ref|YP_004102477.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]