SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317122524|ref|YP_004102527.1| from Thermaerobacter marianensis DSM 12885

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317122524|ref|YP_004102527.1|
Domain Number 1 Region: 2-75,160-334
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.19e-64
Family Bacterial dinuclear zinc exopeptidases 0.00000813
Further Details:      
 
Domain Number 2 Region: 65-168
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 2.59e-20
Family Aminopeptidase/glucanase lid domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317122524|ref|YP_004102527.1|
Sequence length 344
Comment cellulase [Thermaerobacter marianensis DSM 12885]
Sequence
MLLARLSEARGVSGDEAAVRELILEAVLPSIDAYRIDSMGNLLVVKGKNKSGPRVMVAAH
MDEVGLMITRVEKNGLLRFAKVGGLDDRLLPGKRVRVGPDGVPGVIGSKPIHLDRRASSV
TPSDELYIDIGATSREAAEKLVRPGHYATFDTAFGEFGQGCWKGKAFDDRVGCALLIELL
RGDYDFPLYGAFTVQEEVGLRGAATAAYAIHPDVALVLEGTTCADIPGADEHGQSTRLGH
GPAITAMDRTVIPPRWLTDRLVAAAERRGIPYQWKRTTFGGTDAGRIHQVRAGVPSAVVS
VPCRYIHSPCAVMSRQDFENAQQLVRGFLEDLNEGGVPRHGDPS
Download sequence
Identical sequences E6SHK5
WP_013496101.1.7975 gi|317122524|ref|YP_004102527.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]