SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374337628|ref|YP_005094333.1| from Streptococcus macedonicus ACA-DC 198

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374337628|ref|YP_005094333.1|
Domain Number 1 Region: 11-393
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 6.28e-136
Family ArgJ-like 0.00000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374337628|ref|YP_005094333.1|
Sequence length 397
Comment glutamate N-acetyltransferase/N-acetylglutamate synthase [Streptococcus macedonicus ACA-DC 198]
Sequence
MKVIEGNVASPLGFSADGLHAGFKKRKLDFGWIVSEVPASVSGVYTTNKVIAAPLIVTRN
SIKKAQKMKAIVVNSGVANSCTGVQGMEDAYIMQKWTAEKLGVEPDLVGIASTGVIGDLL
PMDTLKTGLSKLVVNGNSDDFSKAILTTDTMVKTVAVTEKFGRDEVTMAGVAKGSGMIHP
NMATMLAFITCDANISSETLQLALSQNVETTFNQITVDGDTSTNDMVLVLSNGCTLNEEI
LPDTPEFDKFSAMLNYVMQELAKKIAKDGEGASKLIEVNVKNAPNALDARMMAKSVVGSS
LVKTAIFGEDPNWGRILAAVGYAGVDVPVDNIDIYLGDIPVMLKSSPVDFEAEEMQDIMH
EDEITITVDLHSGEAVGKAWGCDLSYDYVKINALYRT
Download sequence
Identical sequences A0A0U3F405 A0A2G3NXX5 H2A5F2
WP_014294225.1.28603 WP_014294225.1.48819 gi|374337628|ref|YP_005094333.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]