SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|51598672|ref|YP_072860.1| from Borrelia garinii PBi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51598672|ref|YP_072860.1|
Domain Number 1 Region: 187-371
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.1e-60
Family Methylesterase CheB, C-terminal domain 0.00000653
Further Details:      
 
Domain Number 2 Region: 4-103
Classification Level Classification E-value
Superfamily CheY-like 0.00000000466
Family CheY-related 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|51598672|ref|YP_072860.1|
Sequence length 375
Comment protein-glutamate methylesterase [Borrelia garinii PBi]
Sequence
METKISVLIIEYFAVKRKLISDLINSSPKLQVIATASNGKFATNKLKKHNPEVILMNLEE
NNIKDILFLEKKNNINKTIPIIVTSSNQNLINIAALKGADDLILVSKNKKSHEIKKEQII
NSLLAYGSISIKNKIVCNKDMKIKNYEGARIFLNHKNDIFSLNKLEEHTKEKILNEKEIK
KLKLRKFDIIAIGISAGGPVALKSILPEIPESFPPIIIVQHMPKGFTEEFAKNLNNLCKI
RVKETANKEILKQGHAYISSGGYHTKIQKIDGNYKIQIFDGKHINGHKPSIGVLFQSIAE
IAKDKAIALIMTGMGNDGSREIGDIKKAGGLTIAQDKESSMVFGMPKIAIKENNIDYIVP
LNHMVKLLKAILIDS
Download sequence
Identical sequences Q661K3
290434.BG0418 gi|51598672|ref|YP_072860.1| WP_011193740.1.42220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]