SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|51598819|ref|YP_073007.1| from Borrelia garinii PBi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51598819|ref|YP_073007.1|
Domain Number 1 Region: 198-383
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.22e-66
Family Methylesterase CheB, C-terminal domain 0.00000227
Further Details:      
 
Weak hits

Sequence:  gi|51598819|ref|YP_073007.1|
Domain Number - Region: 123-210
Classification Level Classification E-value
Superfamily Ribosomal protein S8 0.049
Family Ribosomal protein S8 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|51598819|ref|YP_073007.1|
Sequence length 385
Comment protein-glutamate methylesterase [Borrelia garinii PBi]
Sequence
MKILVIDIQGLIKQVFIRAFSKDNDVEILNAGFNSLNLINVFLQKFPDLVIIDENTARSN
FGNSLNNVLNNISLPVVFIAQNEMFPNFGCLEQSKEKVKLIINKLNFKLTVDLFRSKYLA
LIKLELRNLGKNKLISSYEVKRISAPDFSSHSKVELRGNSLDDSSIRKSYRVSDVINFAP
KNDPDVIIKYQGLLNKHKTGKIIVVGSSTGGTEALRIFLSSFKKDSPPIIIVQHMPGGFT
KSFAKNLNNEFNIDIKEAEDGDILRPGLVIIANGSYHLIVKYGSGNYFVNLLDGPLVSRH
KPSVNVLFRSAAMYAGSNAIGVILTGMGDDGAICMLEMKKNGAYTIAQDQETSVVFGMPM
EAIKIGAVYKILPLSKIADHVLRRS
Download sequence
Identical sequences Q660V6
gi|51598819|ref|YP_073007.1| WP_011193874.1.42220 290434.BG0578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]