SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384543191|ref|YP_005727253.1| from Shigella flexneri 2002017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384543191|ref|YP_005727253.1|
Domain Number 1 Region: 5-143
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.73e-30
Family MarR-like transcriptional regulators 0.000000404
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384543191|ref|YP_005727253.1|
Sequence length 144
Comment Multiple antibiotic resistance protein marR [Shigella flexneri 2002017]
Sequence
MKSTSDLFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVEL
KKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTSGAAICEQCHQLVGQDLH
QELTKNLTADEVATLEHLLKKVLP
Download sequence
Identical sequences A0A023YX41 A0A024KWH2 A0A025BR56 A0A026V4P6 A0A027U484 A0A027ZRI8 A0A028E0A1 A0A029I1A0 A0A029IUR3 A0A070FKJ0 A0A073FW04 A0A073HJ07 A0A073U9W0 A0A074I429 A0A080FZ40 A0A080IXT0 A0A090NA74 A0A0A0FFY2 A0A0A6ZSQ6 A0A0A8UDS9 A0A0E0TYC7 A0A0E0V642 A0A0E0Y0N9 A0A0E2TJM1 A0A0F6C479 A0A0F6F6C6 A0A0F6MDT5 A0A0G3K792 A0A0H2V9P4 A0A0H3MQX3 A0A0H3PLI3 A0A0I5D9K7 A0A0K9T4Q1 A0A0R5RP77 A0A127GKD6 A0A127SJS0 A0A192C732 A0A1E2VK48 A0A1E3MXQ2 A0A1Q8MUV0 A0A1S6TAS1 A0A1S9JRH1 A0A1X3IMU1 A0A1X3J2J3 A0A1X3L2S5 A0A1X3LJT4 A0A1X3LXJ8 A0A222QL92 A0A226K7F0 A0A2H1BQ43 A0A2J9MS41 A7ZLY6 B1LF83 B2U165 B6IAT3 B7L8K9 B7MUT9 B7N4V5 C8U8K0 C8UPW9 D2AFQ7 D3GSG7 D3QT78 D6HX43 D6IAM9 D6J9Y0 E0IX61 E3PM31 E7SET6 E7T8S6 F4NFW8 F4SZ90 F4TG50 F4V233 F4VFD5 F5N1F9 F5NU93 I0VM26 I2SSN4 I2UFV0 I2WAI0 I2WPG0 I4SDZ2 I6BRB4 I6ED15 I6FX94 K0X6S2 K4VHZ7 L3BIB5 L3P8A7 L3Q708 L4JAI1 L4VPU6 M9H596 Q0T4J9 Q7BBV5 Q9AGA4 S0XTB9 S0ZH85 S1DA85 S1ELQ1 S1GXA1 S1I7S2 S1IA16 T6I344 T6M3L9 T9AEX8 T9DC38 T9SVA4 V6FW76 V8FDY0 W1EXV6 W1X1D6 W8ZS63
gi|386619132|ref|YP_006138712.1| gi|161984932|ref|YP_408084.2| gi|386709352|ref|YP_006173073.1| gi|218695067|ref|YP_002402734.1| 155864.Z2171 198215.S1691 199310.c1952 300267.SDY_1597 300268.SBO_1648 300269.SSON_1598 331111.EcE24377A_1732 331112.EcHS_A1612 344609.SbBS512_E1675 373384.SFV_1590 386585.ECs2137 409438.ECSE_1620 439855.EcSMS35_1640 444450.ECH74115_2144 481805.EcolC_2128 544404.ECSP_2015 573235.ECO26_2132 585034.ECIAI1_1543 585055.EC55989_1665 585056.ECUMN_1798 585057.ECIAI39_1826 585395.ECO103_1661 585396.ECO111_1927 585397.ECED1_1658 gi|260855244|ref|YP_003229135.1| gi|387882543|ref|YP_006312845.1| gi|560156856|ref|YP_008849571.1| gi|443617597|ref|YP_007381453.1| gi|556551575|ref|YP_008721712.1| gi|291282633|ref|YP_003499451.1| gi|407482106|ref|YP_006779255.1| gi|386614043|ref|YP_006133709.1| gi|410482655|ref|YP_006770201.1| gi|209400719|ref|YP_002270528.1| gi|110805551|ref|YP_689071.1| gi|161367610|ref|NP_287622.2| gi|387607117|ref|YP_006095973.1| gi|218700177|ref|YP_002407806.1| gi|161486491|ref|NP_837240.2| gi|170020141|ref|YP_001725095.1| gi|260843834|ref|YP_003221612.1| gi|218689420|ref|YP_002397632.1| gi|407469232|ref|YP_006784326.1| gi|378713067|ref|YP_005277960.1| gi|387612057|ref|YP_006115173.1| gi|170683414|ref|YP_001743694.1| gi|384543191|ref|YP_005727253.1| gi|254793075|ref|YP_003077912.1| gi|260867968|ref|YP_003234370.1| gi|218554063|ref|YP_002386976.1| gi|38703989|ref|NP_310164.2| gi|386629248|ref|YP_006148968.1| gi|209918811|ref|YP_002292895.1| gi|383178373|ref|YP_005456378.1| gi|378713067|ref|YP_005277960.1| NP_310164.2.58667 WP_000843419.1.1000 WP_000843419.1.10001 WP_000843419.1.100014 WP_000843419.1.100044 WP_000843419.1.100063 WP_000843419.1.100066 WP_000843419.1.100073 WP_000843419.1.10010 WP_000843419.1.100116 WP_000843419.1.100135 WP_000843419.1.100151 WP_000843419.1.100159 WP_000843419.1.100185 WP_000843419.1.100194 WP_000843419.1.100227 WP_000843419.1.100281 WP_000843419.1.100283 WP_000843419.1.100285 WP_000843419.1.100299 WP_000843419.1.100302 WP_000843419.1.100304 WP_000843419.1.100306 WP_000843419.1.100315 WP_000843419.1.100346 WP_000843419.1.100389 WP_000843419.1.100425 WP_000843419.1.100444 WP_000843419.1.100447 WP_000843419.1.100448 WP_000843419.1.100474 WP_000843419.1.10048 WP_000843419.1.100487 WP_000843419.1.100496 WP_000843419.1.100499 WP_000843419.1.100508 WP_000843419.1.100543 WP_000843419.1.100554 WP_000843419.1.100571 WP_000843419.1.100573 WP_000843419.1.100667 WP_000843419.1.10067 WP_000843419.1.10068 WP_000843419.1.100688 WP_000843419.1.100689 WP_000843419.1.100718 WP_000843419.1.100725 WP_000843419.1.100752 WP_000843419.1.100758 WP_000843419.1.100778 WP_000843419.1.100796 WP_000843419.1.10080 WP_000843419.1.100803 WP_000843419.1.100836 WP_000843419.1.100852 WP_000843419.1.10086 WP_000843419.1.100867 WP_000843419.1.100916 WP_000843419.1.100925 WP_000843419.1.100928 WP_000843419.1.100933 WP_000843419.1.10094 WP_000843419.1.100959 WP_000843419.1.100966 WP_000843419.1.100990 WP_000843419.1.10100 WP_000843419.1.101052 WP_000843419.1.101087 WP_000843419.1.101096 WP_000843419.1.1011 WP_000843419.1.101102 WP_000843419.1.101105 WP_000843419.1.101110 WP_000843419.1.101121 WP_000843419.1.101148 WP_000843419.1.101152 WP_000843419.1.101157 WP_000843419.1.101166 WP_000843419.1.101175 WP_000843419.1.101206 WP_000843419.1.101214 WP_000843419.1.101216 WP_000843419.1.101255 WP_000843419.1.10126 WP_000843419.1.101289 WP_000843419.1.101313 WP_000843419.1.101359 WP_000843419.1.10138 WP_000843419.1.101387 WP_000843419.1.101399 WP_000843419.1.101418 WP_000843419.1.101436 WP_000843419.1.101445 WP_000843419.1.101468 WP_000843419.1.101486 WP_000843419.1.101518 WP_000843419.1.101522 WP_000843419.1.10154 WP_000843419.1.101545 WP_000843419.1.101583 WP_000843419.1.101594 WP_000843419.1.101628 WP_000843419.1.101630 WP_000843419.1.101651 WP_000843419.1.101653 WP_000843419.1.101667 WP_000843419.1.101668 WP_000843419.1.101686 WP_000843419.1.101693 WP_000843419.1.101694 WP_000843419.1.101700 WP_000843419.1.101727 WP_000843419.1.10173 WP_000843419.1.101777 WP_000843419.1.101786 WP_000843419.1.10181 WP_000843419.1.10184 WP_000843419.1.101840 WP_000843419.1.101845 WP_000843419.1.101855 WP_000843419.1.101865 WP_000843419.1.10187 WP_000843419.1.101887 WP_000843419.1.101889 WP_000843419.1.10190 WP_000843419.1.101900 WP_000843419.1.101908 WP_000843419.1.101913 WP_000843419.1.101932 WP_000843419.1.101937 WP_000843419.1.101940 WP_000843419.1.101942 WP_000843419.1.101947 WP_000843419.1.101952 WP_000843419.1.101964 WP_000843419.1.101969 WP_000843419.1.101977 WP_000843419.1.101984 WP_000843419.1.101987 WP_000843419.1.102021 WP_000843419.1.102036 WP_000843419.1.10206 WP_000843419.1.102069 WP_000843419.1.102076 WP_000843419.1.102093 WP_000843419.1.102094 WP_000843419.1.102104 WP_000843419.1.102106 WP_000843419.1.102122 WP_000843419.1.102139 WP_000843419.1.10222 WP_000843419.1.10233 WP_000843419.1.10273 WP_000843419.1.10329 WP_000843419.1.10335 WP_000843419.1.10348 WP_000843419.1.10352 WP_000843419.1.10361 WP_000843419.1.10379 WP_000843419.1.10381 WP_000843419.1.1040 WP_000843419.1.10400 WP_000843419.1.10461 WP_000843419.1.10476 WP_000843419.1.10508 WP_000843419.1.10524 WP_000843419.1.10525 WP_000843419.1.10538 WP_000843419.1.10569 WP_000843419.1.10573 WP_000843419.1.10576 WP_000843419.1.10579 WP_000843419.1.1058 WP_000843419.1.10605 WP_000843419.1.10607 WP_000843419.1.10628 WP_000843419.1.10651 WP_000843419.1.10673 WP_000843419.1.1071 WP_000843419.1.10715 WP_000843419.1.10729 WP_000843419.1.10761 WP_000843419.1.10763 WP_000843419.1.10771 WP_000843419.1.10786 WP_000843419.1.10798 WP_000843419.1.10809 WP_000843419.1.10814 WP_000843419.1.10824 WP_000843419.1.10842 WP_000843419.1.10849 WP_000843419.1.10862 WP_000843419.1.10869 WP_000843419.1.10940 WP_000843419.1.10970 WP_000843419.1.10988 WP_000843419.1.10989 WP_000843419.1.10994 WP_000843419.1.10995 WP_000843419.1.11006 WP_000843419.1.11032 WP_000843419.1.11052 WP_000843419.1.11068 WP_000843419.1.11071 WP_000843419.1.11091 WP_000843419.1.1111 WP_000843419.1.11121 WP_000843419.1.11133 WP_000843419.1.112 WP_000843419.1.1122 WP_000843419.1.11240 WP_000843419.1.11241 WP_000843419.1.11251 WP_000843419.1.11265 WP_000843419.1.11272 WP_000843419.1.11285 WP_000843419.1.11301 WP_000843419.1.11315 WP_000843419.1.11323 WP_000843419.1.11399 WP_000843419.1.11411 WP_000843419.1.11418 WP_000843419.1.11420 WP_000843419.1.11436 WP_000843419.1.11437 WP_000843419.1.11440 WP_000843419.1.11452 WP_000843419.1.11499 WP_000843419.1.11524 WP_000843419.1.11542 WP_000843419.1.11575 WP_000843419.1.11578 WP_000843419.1.11595 WP_000843419.1.11607 WP_000843419.1.11612 WP_000843419.1.11616 WP_000843419.1.11645 WP_000843419.1.11671 WP_000843419.1.11673 WP_000843419.1.1168 WP_000843419.1.11690 WP_000843419.1.11699 WP_000843419.1.11748 WP_000843419.1.11759 WP_000843419.1.1176 WP_000843419.1.11762 WP_000843419.1.11801 WP_000843419.1.11803 WP_000843419.1.11844 WP_000843419.1.1186 WP_000843419.1.11912 WP_000843419.1.1196 WP_000843419.1.11981 WP_000843419.1.11985 WP_000843419.1.12000 WP_000843419.1.12030 WP_000843419.1.12036 WP_000843419.1.12051 WP_000843419.1.12088 WP_000843419.1.12095 WP_000843419.1.12111 WP_000843419.1.12112 WP_000843419.1.12115 WP_000843419.1.12151 WP_000843419.1.12157 WP_000843419.1.12174 WP_000843419.1.1218 WP_000843419.1.12204 WP_000843419.1.12259 WP_000843419.1.12268 WP_000843419.1.12292 WP_000843419.1.12295 WP_000843419.1.12305 WP_000843419.1.12319 WP_000843419.1.12320 WP_000843419.1.12344 WP_000843419.1.12352 WP_000843419.1.1242 WP_000843419.1.12426 WP_000843419.1.12459 WP_000843419.1.12468 WP_000843419.1.12478 WP_000843419.1.12552 WP_000843419.1.12566 WP_000843419.1.12574 WP_000843419.1.12594 WP_000843419.1.12623 WP_000843419.1.12645 WP_000843419.1.12646 WP_000843419.1.12679 WP_000843419.1.12693 WP_000843419.1.12697 WP_000843419.1.12717 WP_000843419.1.12743 WP_000843419.1.12749 WP_000843419.1.1275 WP_000843419.1.12762 WP_000843419.1.12766 WP_000843419.1.1278 WP_000843419.1.12781 WP_000843419.1.1280 WP_000843419.1.12826 WP_000843419.1.12830 WP_000843419.1.12831 WP_000843419.1.12876 WP_000843419.1.12911 WP_000843419.1.12917 WP_000843419.1.1295 WP_000843419.1.12956 WP_000843419.1.12965 WP_000843419.1.12976 WP_000843419.1.12979 WP_000843419.1.12987 WP_000843419.1.12991 WP_000843419.1.13015 WP_000843419.1.13060 WP_000843419.1.13074 WP_000843419.1.13117 WP_000843419.1.13144 WP_000843419.1.1315 WP_000843419.1.13157 WP_000843419.1.13162 WP_000843419.1.13205 WP_000843419.1.13217 WP_000843419.1.13222 WP_000843419.1.13223 WP_000843419.1.13252 WP_000843419.1.13271 WP_000843419.1.13272 WP_000843419.1.13278 WP_000843419.1.13290 WP_000843419.1.13295 WP_000843419.1.13301 WP_000843419.1.13332 WP_000843419.1.13346 WP_000843419.1.13348 WP_000843419.1.1335 WP_000843419.1.13383 WP_000843419.1.13393 WP_000843419.1.13411 WP_000843419.1.1343 WP_000843419.1.13430 WP_000843419.1.13437 WP_000843419.1.13442 WP_000843419.1.13451 WP_000843419.1.13481 WP_000843419.1.13492 WP_000843419.1.13495 WP_000843419.1.13525 WP_000843419.1.13566 WP_000843419.1.13589 WP_000843419.1.13601 WP_000843419.1.13608 WP_000843419.1.13624 WP_000843419.1.13626 WP_000843419.1.13644 WP_000843419.1.13656 WP_000843419.1.13662 WP_000843419.1.13664 WP_000843419.1.13672 WP_000843419.1.13740 WP_000843419.1.13778 WP_000843419.1.13791 WP_000843419.1.13798 WP_000843419.1.13867 WP_000843419.1.13877 WP_000843419.1.13881 WP_000843419.1.13891 WP_000843419.1.13924 WP_000843419.1.13934 WP_000843419.1.13936 WP_000843419.1.13939 WP_000843419.1.13944 WP_000843419.1.13974 WP_000843419.1.13981 WP_000843419.1.14042 WP_000843419.1.14058 WP_000843419.1.14062 WP_000843419.1.14070 WP_000843419.1.14094 WP_000843419.1.14110 WP_000843419.1.14127 WP_000843419.1.14129 WP_000843419.1.14154 WP_000843419.1.14199 WP_000843419.1.142 WP_000843419.1.14245 WP_000843419.1.14253 WP_000843419.1.14292 WP_000843419.1.14299 WP_000843419.1.14304 WP_000843419.1.14371 WP_000843419.1.1438 WP_000843419.1.14389 WP_000843419.1.1439 WP_000843419.1.14398 WP_000843419.1.14417 WP_000843419.1.14432 WP_000843419.1.14445 WP_000843419.1.14451 WP_000843419.1.14453 WP_000843419.1.14468 WP_000843419.1.14493 WP_000843419.1.14499 WP_000843419.1.14501 WP_000843419.1.14506 WP_000843419.1.14508 WP_000843419.1.14536 WP_000843419.1.14581 WP_000843419.1.14582 WP_000843419.1.14600 WP_000843419.1.14601 WP_000843419.1.14621 WP_000843419.1.14648 WP_000843419.1.14661 WP_000843419.1.14678 WP_000843419.1.14687 WP_000843419.1.14693 WP_000843419.1.1470 WP_000843419.1.14711 WP_000843419.1.14746 WP_000843419.1.14748 WP_000843419.1.14807 WP_000843419.1.1486 WP_000843419.1.14861 WP_000843419.1.14879 WP_000843419.1.14914 WP_000843419.1.14934 WP_000843419.1.14935 WP_000843419.1.14956 WP_000843419.1.14958 WP_000843419.1.14963 WP_000843419.1.14965 WP_000843419.1.14977 WP_000843419.1.14993 WP_000843419.1.15007 WP_000843419.1.15041 WP_000843419.1.1508 WP_000843419.1.15087 WP_000843419.1.15090 WP_000843419.1.1510 WP_000843419.1.15117 WP_000843419.1.15138 WP_000843419.1.15148 WP_000843419.1.15191 WP_000843419.1.15193 WP_000843419.1.15207 WP_000843419.1.15221 WP_000843419.1.1524 WP_000843419.1.15245 WP_000843419.1.15252 WP_000843419.1.15270 WP_000843419.1.15277 WP_000843419.1.15282 WP_000843419.1.15287 WP_000843419.1.15290 WP_000843419.1.153 WP_000843419.1.15304 WP_000843419.1.15332 WP_000843419.1.15335 WP_000843419.1.15356 WP_000843419.1.15377 WP_000843419.1.15416 WP_000843419.1.15420 WP_000843419.1.1543 WP_000843419.1.15444 WP_000843419.1.15453 WP_000843419.1.15469 WP_000843419.1.1550 WP_000843419.1.15503 WP_000843419.1.15521 WP_000843419.1.15527 WP_000843419.1.15528 WP_000843419.1.15538 WP_000843419.1.15565 WP_000843419.1.15583 WP_000843419.1.15593 WP_000843419.1.15600 WP_000843419.1.1561 WP_000843419.1.15620 WP_000843419.1.15624 WP_000843419.1.15626 WP_000843419.1.15654 WP_000843419.1.15702 WP_000843419.1.15707 WP_000843419.1.15731 WP_000843419.1.15752 WP_000843419.1.15762 WP_000843419.1.15767 WP_000843419.1.15768 WP_000843419.1.15771 WP_000843419.1.15782 WP_000843419.1.15791 WP_000843419.1.1580 WP_000843419.1.15809 WP_000843419.1.1582 WP_000843419.1.15863 WP_000843419.1.15894 WP_000843419.1.15906 WP_000843419.1.15916 WP_000843419.1.15945 WP_000843419.1.15951 WP_000843419.1.15990 WP_000843419.1.16014 WP_000843419.1.16015 WP_000843419.1.1604 WP_000843419.1.16042 WP_000843419.1.16067 WP_000843419.1.16075 WP_000843419.1.16087 WP_000843419.1.16102 WP_000843419.1.16117 WP_000843419.1.16133 WP_000843419.1.16154 WP_000843419.1.16171 WP_000843419.1.16175 WP_000843419.1.16183 WP_000843419.1.16188 WP_000843419.1.16194 WP_000843419.1.1621 WP_000843419.1.1622 WP_000843419.1.16222 WP_000843419.1.16270 WP_000843419.1.16272 WP_000843419.1.163 WP_000843419.1.16303 WP_000843419.1.16322 WP_000843419.1.1634 WP_000843419.1.16387 WP_000843419.1.16388 WP_000843419.1.16396 WP_000843419.1.1640 WP_000843419.1.16481 WP_000843419.1.16482 WP_000843419.1.16500 WP_000843419.1.16517 WP_000843419.1.16539 WP_000843419.1.1655 WP_000843419.1.16592 WP_000843419.1.16604 WP_000843419.1.16608 WP_000843419.1.16612 WP_000843419.1.16640 WP_000843419.1.16648 WP_000843419.1.16669 WP_000843419.1.16682 WP_000843419.1.16685 WP_000843419.1.16700 WP_000843419.1.16705 WP_000843419.1.1673 WP_000843419.1.16745 WP_000843419.1.16780 WP_000843419.1.16799 WP_000843419.1.16805 WP_000843419.1.16807 WP_000843419.1.16845 WP_000843419.1.16861 WP_000843419.1.16862 WP_000843419.1.16894 WP_000843419.1.16970 WP_000843419.1.16979 WP_000843419.1.16992 WP_000843419.1.17017 WP_000843419.1.17042 WP_000843419.1.17061 WP_000843419.1.17085 WP_000843419.1.17089 WP_000843419.1.1710 WP_000843419.1.17101 WP_000843419.1.17102 WP_000843419.1.17109 WP_000843419.1.17111 WP_000843419.1.17119 WP_000843419.1.17150 WP_000843419.1.17153 WP_000843419.1.17170 WP_000843419.1.17172 WP_000843419.1.17182 WP_000843419.1.17186 WP_000843419.1.17187 WP_000843419.1.17205 WP_000843419.1.17206 WP_000843419.1.17216 WP_000843419.1.17230 WP_000843419.1.17241 WP_000843419.1.17242 WP_000843419.1.1726 WP_000843419.1.17267 WP_000843419.1.17282 WP_000843419.1.17290 WP_000843419.1.17297 WP_000843419.1.17300 WP_000843419.1.17301 WP_000843419.1.1731 WP_000843419.1.17325 WP_000843419.1.17333 WP_000843419.1.17356 WP_000843419.1.17373 WP_000843419.1.17386 WP_000843419.1.17389 WP_000843419.1.17392 WP_000843419.1.17403 WP_000843419.1.17410 WP_000843419.1.17415 WP_000843419.1.17441 WP_000843419.1.17464 WP_000843419.1.17496 WP_000843419.1.17515 WP_000843419.1.17534 WP_000843419.1.17550 WP_000843419.1.17568 WP_000843419.1.17570 WP_000843419.1.17595 WP_000843419.1.17623 WP_000843419.1.1763 WP_000843419.1.17637 WP_000843419.1.1766 WP_000843419.1.1769 WP_000843419.1.17701 WP_000843419.1.17711 WP_000843419.1.1772 WP_000843419.1.17734 WP_000843419.1.17757 WP_000843419.1.17765 WP_000843419.1.17766 WP_000843419.1.17769 WP_000843419.1.1778 WP_000843419.1.17802 WP_000843419.1.17829 WP_000843419.1.17831 WP_000843419.1.17836 WP_000843419.1.17849 WP_000843419.1.17889 WP_000843419.1.17904 WP_000843419.1.17920 WP_000843419.1.17925 WP_000843419.1.17937 WP_000843419.1.17952 WP_000843419.1.17961 WP_000843419.1.17963 WP_000843419.1.17984 WP_000843419.1.18000 WP_000843419.1.18006 WP_000843419.1.18024 WP_000843419.1.18050 WP_000843419.1.18064 WP_000843419.1.18094 WP_000843419.1.18112 WP_000843419.1.18133 WP_000843419.1.18134 WP_000843419.1.18136 WP_000843419.1.18164 WP_000843419.1.18175 WP_000843419.1.18225 WP_000843419.1.18226 WP_000843419.1.18229 WP_000843419.1.18275 WP_000843419.1.18311 WP_000843419.1.18316 WP_000843419.1.18326 WP_000843419.1.18337 WP_000843419.1.18338 WP_000843419.1.1834 WP_000843419.1.18348 WP_000843419.1.18354 WP_000843419.1.18383 WP_000843419.1.18394 WP_000843419.1.18410 WP_000843419.1.18436 WP_000843419.1.18438 WP_000843419.1.1844 WP_000843419.1.18458 WP_000843419.1.18461 WP_000843419.1.18482 WP_000843419.1.18511 WP_000843419.1.18530 WP_000843419.1.18556 WP_000843419.1.18583 WP_000843419.1.1861 WP_000843419.1.1862 WP_000843419.1.18628 WP_000843419.1.18649 WP_000843419.1.18650 WP_000843419.1.1866 WP_000843419.1.18666 WP_000843419.1.1867 WP_000843419.1.18675 WP_000843419.1.18699 WP_000843419.1.18714 WP_000843419.1.18725 WP_000843419.1.18734 WP_000843419.1.188 WP_000843419.1.18801 WP_000843419.1.18806 WP_000843419.1.1881 WP_000843419.1.18837 WP_000843419.1.18843 WP_000843419.1.18858 WP_000843419.1.18861 WP_000843419.1.18874 WP_000843419.1.18899 WP_000843419.1.18908 WP_000843419.1.18923 WP_000843419.1.18929 WP_000843419.1.18936 WP_000843419.1.1896 WP_000843419.1.18966 WP_000843419.1.18983 WP_000843419.1.18995 WP_000843419.1.19024 WP_000843419.1.1903 WP_000843419.1.19036 WP_000843419.1.19039 WP_000843419.1.1906 WP_000843419.1.19075 WP_000843419.1.1909 WP_000843419.1.19090 WP_000843419.1.191 WP_000843419.1.19113 WP_000843419.1.19114 WP_000843419.1.19122 WP_000843419.1.19129 WP_000843419.1.19140 WP_000843419.1.19147 WP_000843419.1.19148 WP_000843419.1.1915 WP_000843419.1.19153 WP_000843419.1.19171 WP_000843419.1.19206 WP_000843419.1.19245 WP_000843419.1.1925 WP_000843419.1.19276 WP_000843419.1.19312 WP_000843419.1.19314 WP_000843419.1.19315 WP_000843419.1.19332 WP_000843419.1.19338 WP_000843419.1.19347 WP_000843419.1.19350 WP_000843419.1.19361 WP_000843419.1.19374 WP_000843419.1.19389 WP_000843419.1.19397 WP_000843419.1.19419 WP_000843419.1.19424 WP_000843419.1.19441 WP_000843419.1.19448 WP_000843419.1.19453 WP_000843419.1.19478 WP_000843419.1.19487 WP_000843419.1.19494 WP_000843419.1.1952 WP_000843419.1.19534 WP_000843419.1.19544 WP_000843419.1.19547 WP_000843419.1.19557 WP_000843419.1.19581 WP_000843419.1.19583 WP_000843419.1.19593 WP_000843419.1.1960 WP_000843419.1.19602 WP_000843419.1.19644 WP_000843419.1.19649 WP_000843419.1.19651 WP_000843419.1.19655 WP_000843419.1.19661 WP_000843419.1.19684 WP_000843419.1.19758 WP_000843419.1.19761 WP_000843419.1.19778 WP_000843419.1.19795 WP_000843419.1.19830 WP_000843419.1.19838 WP_000843419.1.19840 WP_000843419.1.19845 WP_000843419.1.19847 WP_000843419.1.19873 WP_000843419.1.19878 WP_000843419.1.19945 WP_000843419.1.19972 WP_000843419.1.19994 WP_000843419.1.20025 WP_000843419.1.2005 WP_000843419.1.20096 WP_000843419.1.20114 WP_000843419.1.20129 WP_000843419.1.20133 WP_000843419.1.20136 WP_000843419.1.2015 WP_000843419.1.20151 WP_000843419.1.20157 WP_000843419.1.20159 WP_000843419.1.20166 WP_000843419.1.20178 WP_000843419.1.20183 WP_000843419.1.20192 WP_000843419.1.20215 WP_000843419.1.2022 WP_000843419.1.20230 WP_000843419.1.20238 WP_000843419.1.20251 WP_000843419.1.20264 WP_000843419.1.20277 WP_000843419.1.20290 WP_000843419.1.20308 WP_000843419.1.20325 WP_000843419.1.20334 WP_000843419.1.20370 WP_000843419.1.20388 WP_000843419.1.20445 WP_000843419.1.20449 WP_000843419.1.20480 WP_000843419.1.20483 WP_000843419.1.20484 WP_000843419.1.20506 WP_000843419.1.20515 WP_000843419.1.20519 WP_000843419.1.20546 WP_000843419.1.20549 WP_000843419.1.20575 WP_000843419.1.20594 WP_000843419.1.20596 WP_000843419.1.20609 WP_000843419.1.20636 WP_000843419.1.20640 WP_000843419.1.20662 WP_000843419.1.20668 WP_000843419.1.20691 WP_000843419.1.20730 WP_000843419.1.20741 WP_000843419.1.2075 WP_000843419.1.20765 WP_000843419.1.20784 WP_000843419.1.20785 WP_000843419.1.20813 WP_000843419.1.20818 WP_000843419.1.20824 WP_000843419.1.20831 WP_000843419.1.20848 WP_000843419.1.20863 WP_000843419.1.20893 WP_000843419.1.20907 WP_000843419.1.2093 WP_000843419.1.20933 WP_000843419.1.2094 WP_000843419.1.20941 WP_000843419.1.20943 WP_000843419.1.20950 WP_000843419.1.20958 WP_000843419.1.20962 WP_000843419.1.20989 WP_000843419.1.21022 WP_000843419.1.21024 WP_000843419.1.21029 WP_000843419.1.21041 WP_000843419.1.21059 WP_000843419.1.21104 WP_000843419.1.21129 WP_000843419.1.2113 WP_000843419.1.21131 WP_000843419.1.21137 WP_000843419.1.21152 WP_000843419.1.21171 WP_000843419.1.21197 WP_000843419.1.21236 WP_000843419.1.21251 WP_000843419.1.21255 WP_000843419.1.21266 WP_000843419.1.21277 WP_000843419.1.21305 WP_000843419.1.21320 WP_000843419.1.21336 WP_000843419.1.21378 WP_000843419.1.2142 WP_000843419.1.21441 WP_000843419.1.21450 WP_000843419.1.21455 WP_000843419.1.21508 WP_000843419.1.21526 WP_000843419.1.21537 WP_000843419.1.21578 WP_000843419.1.21596 WP_000843419.1.21614 WP_000843419.1.21628 WP_000843419.1.21637 WP_000843419.1.2164 WP_000843419.1.21652 WP_000843419.1.21656 WP_000843419.1.21661 WP_000843419.1.21666 WP_000843419.1.21667 WP_000843419.1.21673 WP_000843419.1.21696 WP_000843419.1.21727 WP_000843419.1.21732 WP_000843419.1.21756 WP_000843419.1.21762 WP_000843419.1.21811 WP_000843419.1.21895 WP_000843419.1.21899 WP_000843419.1.21962 WP_000843419.1.2198 WP_000843419.1.21986 WP_000843419.1.21992 WP_000843419.1.22021 WP_000843419.1.22088 WP_000843419.1.22098 WP_000843419.1.22138 WP_000843419.1.22161 WP_000843419.1.2218 WP_000843419.1.22195 WP_000843419.1.22203 WP_000843419.1.22204 WP_000843419.1.22251 WP_000843419.1.22268 WP_000843419.1.22269 WP_000843419.1.22272 WP_000843419.1.22280 WP_000843419.1.22291 WP_000843419.1.22293 WP_000843419.1.22295 WP_000843419.1.22304 WP_000843419.1.2232 WP_000843419.1.22325 WP_000843419.1.22350 WP_000843419.1.22359 WP_000843419.1.22381 WP_000843419.1.22409 WP_000843419.1.2242 WP_000843419.1.22431 WP_000843419.1.22464 WP_000843419.1.22470 WP_000843419.1.22494 WP_000843419.1.22501 WP_000843419.1.22508 WP_000843419.1.22522 WP_000843419.1.22544 WP_000843419.1.22571 WP_000843419.1.22572 WP_000843419.1.22574 WP_000843419.1.22576 WP_000843419.1.22579 WP_000843419.1.22594 WP_000843419.1.22631 WP_000843419.1.22641 WP_000843419.1.22649 WP_000843419.1.22667 WP_000843419.1.22685 WP_000843419.1.22691 WP_000843419.1.22743 WP_000843419.1.22756 WP_000843419.1.22757 WP_000843419.1.22759 WP_000843419.1.22765 WP_000843419.1.22771 WP_000843419.1.22777 WP_000843419.1.22809 WP_000843419.1.22814 WP_000843419.1.22824 WP_000843419.1.22827 WP_000843419.1.22846 WP_000843419.1.22868 WP_000843419.1.22875 WP_000843419.1.22878 WP_000843419.1.22896 WP_000843419.1.22908 WP_000843419.1.22917 WP_000843419.1.22925 WP_000843419.1.22939 WP_000843419.1.22961 WP_000843419.1.22988 WP_000843419.1.22990 WP_000843419.1.22993 WP_000843419.1.2300 WP_000843419.1.23005 WP_000843419.1.23026 WP_000843419.1.23035 WP_000843419.1.23042 WP_000843419.1.23045 WP_000843419.1.23057 WP_000843419.1.23062 WP_000843419.1.23073 WP_000843419.1.23078 WP_000843419.1.23081 WP_000843419.1.23092 WP_000843419.1.23109 WP_000843419.1.23115 WP_000843419.1.23120 WP_000843419.1.23135 WP_000843419.1.2322 WP_000843419.1.23241 WP_000843419.1.2325 WP_000843419.1.23257 WP_000843419.1.23270 WP_000843419.1.23282 WP_000843419.1.23285 WP_000843419.1.23290 WP_000843419.1.23293 WP_000843419.1.23299 WP_000843419.1.23323 WP_000843419.1.23330 WP_000843419.1.23351 WP_000843419.1.23352 WP_000843419.1.23355 WP_000843419.1.23376 WP_000843419.1.23378 WP_000843419.1.23383 WP_000843419.1.23386 WP_000843419.1.23388 WP_000843419.1.23393 WP_000843419.1.23435 WP_000843419.1.23443 WP_000843419.1.23456 WP_000843419.1.23463 WP_000843419.1.23486 WP_000843419.1.23487 WP_000843419.1.23520 WP_000843419.1.23522 WP_000843419.1.23527 WP_000843419.1.2353 WP_000843419.1.23549 WP_000843419.1.23554 WP_000843419.1.23561 WP_000843419.1.23563 WP_000843419.1.23575 WP_000843419.1.23584 WP_000843419.1.23593 WP_000843419.1.2362 WP_000843419.1.23622 WP_000843419.1.23640 WP_000843419.1.23660 WP_000843419.1.23676 WP_000843419.1.23693 WP_000843419.1.23700 WP_000843419.1.23711 WP_000843419.1.23724 WP_000843419.1.23729 WP_000843419.1.23741 WP_000843419.1.23752 WP_000843419.1.23754 WP_000843419.1.23765 WP_000843419.1.23790 WP_000843419.1.23795 WP_000843419.1.23804 WP_000843419.1.23806 WP_000843419.1.23838 WP_000843419.1.23840 WP_000843419.1.23855 WP_000843419.1.2388 WP_000843419.1.23881 WP_000843419.1.23886 WP_000843419.1.23890 WP_000843419.1.23895 WP_000843419.1.23899 WP_000843419.1.23914 WP_000843419.1.23931 WP_000843419.1.2395 WP_000843419.1.23950 WP_000843419.1.23960 WP_000843419.1.23971 WP_000843419.1.23973 WP_000843419.1.23984 WP_000843419.1.23985 WP_000843419.1.24 WP_000843419.1.24004 WP_000843419.1.24024 WP_000843419.1.24051 WP_000843419.1.24058 WP_000843419.1.24068 WP_000843419.1.24070 WP_000843419.1.24088 WP_000843419.1.24089 WP_000843419.1.24120 WP_000843419.1.24122 WP_000843419.1.24124 WP_000843419.1.2413 WP_000843419.1.24136 WP_000843419.1.24177 WP_000843419.1.2418 WP_000843419.1.24194 WP_000843419.1.24278 WP_000843419.1.24283 WP_000843419.1.24290 WP_000843419.1.2430 WP_000843419.1.24304 WP_000843419.1.2433 WP_000843419.1.24341 WP_000843419.1.2437 WP_000843419.1.24374 WP_000843419.1.24381 WP_000843419.1.24383 WP_000843419.1.24458 WP_000843419.1.24460 WP_000843419.1.24473 WP_000843419.1.24483 WP_000843419.1.24485 WP_000843419.1.2449 WP_000843419.1.24499 WP_000843419.1.24523 WP_000843419.1.24524 WP_000843419.1.24533 WP_000843419.1.24536 WP_000843419.1.24547 WP_000843419.1.2456 WP_000843419.1.24560 WP_000843419.1.24570 WP_000843419.1.24575 WP_000843419.1.24592 WP_000843419.1.24641 WP_000843419.1.24642 WP_000843419.1.24646 WP_000843419.1.2469 WP_000843419.1.24693 WP_000843419.1.24695 WP_000843419.1.24703 WP_000843419.1.24752 WP_000843419.1.24753 WP_000843419.1.24763 WP_000843419.1.24773 WP_000843419.1.24783 WP_000843419.1.2479 WP_000843419.1.24791 WP_000843419.1.24797 WP_000843419.1.24799 WP_000843419.1.24808 WP_000843419.1.24849 WP_000843419.1.24854 WP_000843419.1.24870 WP_000843419.1.24876 WP_000843419.1.24906 WP_000843419.1.24926 WP_000843419.1.24929 WP_000843419.1.24939 WP_000843419.1.24946 WP_000843419.1.24968 WP_000843419.1.24979 WP_000843419.1.24981 WP_000843419.1.24984 WP_000843419.1.25019 WP_000843419.1.2502 WP_000843419.1.25038 WP_000843419.1.25039 WP_000843419.1.2504 WP_000843419.1.25042 WP_000843419.1.25050 WP_000843419.1.25060 WP_000843419.1.25076 WP_000843419.1.25082 WP_000843419.1.25086 WP_000843419.1.25087 WP_000843419.1.25088 WP_000843419.1.25126 WP_000843419.1.25183 WP_000843419.1.25201 WP_000843419.1.25204 WP_000843419.1.25248 WP_000843419.1.25289 WP_000843419.1.25305 WP_000843419.1.2531 WP_000843419.1.25346 WP_000843419.1.2537 WP_000843419.1.25378 WP_000843419.1.25380 WP_000843419.1.254 WP_000843419.1.2540 WP_000843419.1.25403 WP_000843419.1.25414 WP_000843419.1.25420 WP_000843419.1.2543 WP_000843419.1.25446 WP_000843419.1.25480 WP_000843419.1.255 WP_000843419.1.25517 WP_000843419.1.25525 WP_000843419.1.25526 WP_000843419.1.25577 WP_000843419.1.2558 WP_000843419.1.25592 WP_000843419.1.25598 WP_000843419.1.25612 WP_000843419.1.25613 WP_000843419.1.25631 WP_000843419.1.25652 WP_000843419.1.2567 WP_000843419.1.25680 WP_000843419.1.25681 WP_000843419.1.25701 WP_000843419.1.25717 WP_000843419.1.25718 WP_000843419.1.25724 WP_000843419.1.25726 WP_000843419.1.25753 WP_000843419.1.25755 WP_000843419.1.25794 WP_000843419.1.25799 WP_000843419.1.25819 WP_000843419.1.25843 WP_000843419.1.25855 WP_000843419.1.25869 WP_000843419.1.25873 WP_000843419.1.2588 WP_000843419.1.25886 WP_000843419.1.2589 WP_000843419.1.25890 WP_000843419.1.25895 WP_000843419.1.25915 WP_000843419.1.25945 WP_000843419.1.2597 WP_000843419.1.26005 WP_000843419.1.26040 WP_000843419.1.26061 WP_000843419.1.26066 WP_000843419.1.26076 WP_000843419.1.26100 WP_000843419.1.26105 WP_000843419.1.2612 WP_000843419.1.26125 WP_000843419.1.26130 WP_000843419.1.26134 WP_000843419.1.26135 WP_000843419.1.26150 WP_000843419.1.26161 WP_000843419.1.26175 WP_000843419.1.26186 WP_000843419.1.26189 WP_000843419.1.26191 WP_000843419.1.26246 WP_000843419.1.26259 WP_000843419.1.26262 WP_000843419.1.26264 WP_000843419.1.26270 WP_000843419.1.26284 WP_000843419.1.26304 WP_000843419.1.26325 WP_000843419.1.26331 WP_000843419.1.2637 WP_000843419.1.26379 WP_000843419.1.26391 WP_000843419.1.26398 WP_000843419.1.26401 WP_000843419.1.26403 WP_000843419.1.26419 WP_000843419.1.2642 WP_000843419.1.26438 WP_000843419.1.26467 WP_000843419.1.26474 WP_000843419.1.26479 WP_000843419.1.26517 WP_000843419.1.26525 WP_000843419.1.26569 WP_000843419.1.26570 WP_000843419.1.26574 WP_000843419.1.26575 WP_000843419.1.26579 WP_000843419.1.26590 WP_000843419.1.26598 WP_000843419.1.26613 WP_000843419.1.26658 WP_000843419.1.26660 WP_000843419.1.26683 WP_000843419.1.26688 WP_000843419.1.26716 WP_000843419.1.26720 WP_000843419.1.26761 WP_000843419.1.26766 WP_000843419.1.26837 WP_000843419.1.26839 WP_000843419.1.26878 WP_000843419.1.26912 WP_000843419.1.26943 WP_000843419.1.26950 WP_000843419.1.26975 WP_000843419.1.26987 WP_000843419.1.26995 WP_000843419.1.26998 WP_000843419.1.2700 WP_000843419.1.27019 WP_000843419.1.27043 WP_000843419.1.27060 WP_000843419.1.27091 WP_000843419.1.27098 WP_000843419.1.27101 WP_000843419.1.27141 WP_000843419.1.27148 WP_000843419.1.27175 WP_000843419.1.27188 WP_000843419.1.27214 WP_000843419.1.27280 WP_000843419.1.27283 WP_000843419.1.27287 WP_000843419.1.27292 WP_000843419.1.2731 WP_000843419.1.27310 WP_000843419.1.27313 WP_000843419.1.27330 WP_000843419.1.27338 WP_000843419.1.27367 WP_000843419.1.27373 WP_000843419.1.27396 WP_000843419.1.27401 WP_000843419.1.27424 WP_000843419.1.27426 WP_000843419.1.27472 WP_000843419.1.27504 WP_000843419.1.27518 WP_000843419.1.27520 WP_000843419.1.27524 WP_000843419.1.2755 WP_000843419.1.27580 WP_000843419.1.27618 WP_000843419.1.27683 WP_000843419.1.27691 WP_000843419.1.27698 WP_000843419.1.27723 WP_000843419.1.27741 WP_000843419.1.27749 WP_000843419.1.27758 WP_000843419.1.27786 WP_000843419.1.2779 WP_000843419.1.27846 WP_000843419.1.27856 WP_000843419.1.27871 WP_000843419.1.27876 WP_000843419.1.27897 WP_000843419.1.27913 WP_000843419.1.27998 WP_000843419.1.28008 WP_000843419.1.28026 WP_000843419.1.28027 WP_000843419.1.28046 WP_000843419.1.28102 WP_000843419.1.28109 WP_000843419.1.2811 WP_000843419.1.28110 WP_000843419.1.28128 WP_000843419.1.28143 WP_000843419.1.28156 WP_000843419.1.28168 WP_000843419.1.28250 WP_000843419.1.2826 WP_000843419.1.28268 WP_000843419.1.28305 WP_000843419.1.28318 WP_000843419.1.28345 WP_000843419.1.28349 WP_000843419.1.28371 WP_000843419.1.28401 WP_000843419.1.28414 WP_000843419.1.28433 WP_000843419.1.28440 WP_000843419.1.28461 WP_000843419.1.28476 WP_000843419.1.28480 WP_000843419.1.28491 WP_000843419.1.28496 WP_000843419.1.28500 WP_000843419.1.28523 WP_000843419.1.28536 WP_000843419.1.28540 WP_000843419.1.28551 WP_000843419.1.28554 WP_000843419.1.28639 WP_000843419.1.2866 WP_000843419.1.28683 WP_000843419.1.28723 WP_000843419.1.28734 WP_000843419.1.28742 WP_000843419.1.28760 WP_000843419.1.28762 WP_000843419.1.28769 WP_000843419.1.28791 WP_000843419.1.28809 WP_000843419.1.2881 WP_000843419.1.28829 WP_000843419.1.28835 WP_000843419.1.28863 WP_000843419.1.28879 WP_000843419.1.28924 WP_000843419.1.28950 WP_000843419.1.28953 WP_000843419.1.290 WP_000843419.1.29001 WP_000843419.1.29013 WP_000843419.1.29016 WP_000843419.1.29026 WP_000843419.1.29049 WP_000843419.1.29055 WP_000843419.1.29079 WP_000843419.1.29082 WP_000843419.1.291 WP_000843419.1.29118 WP_000843419.1.29125 WP_000843419.1.29126 WP_000843419.1.29146 WP_000843419.1.29150 WP_000843419.1.29164 WP_000843419.1.29176 WP_000843419.1.29194 WP_000843419.1.29197 WP_000843419.1.29202 WP_000843419.1.29206 WP_000843419.1.29230 WP_000843419.1.29239 WP_000843419.1.29252 WP_000843419.1.29258 WP_000843419.1.2931 WP_000843419.1.29377 WP_000843419.1.29394 WP_000843419.1.29404 WP_000843419.1.29429 WP_000843419.1.29443 WP_000843419.1.2945 WP_000843419.1.29495 WP_000843419.1.29503 WP_000843419.1.29504 WP_000843419.1.2952 WP_000843419.1.2954 WP_000843419.1.29556 WP_000843419.1.29564 WP_000843419.1.29590 WP_000843419.1.29597 WP_000843419.1.29603 WP_000843419.1.29618 WP_000843419.1.2963 WP_000843419.1.29643 WP_000843419.1.29647 WP_000843419.1.29669 WP_000843419.1.29683 WP_000843419.1.29689 WP_000843419.1.29699 WP_000843419.1.29715 WP_000843419.1.29724 WP_000843419.1.29740 WP_000843419.1.29752 WP_000843419.1.2978 WP_000843419.1.29798 WP_000843419.1.29812 WP_000843419.1.29815 WP_000843419.1.29818 WP_000843419.1.29819 WP_000843419.1.29840 WP_000843419.1.29855 WP_000843419.1.2986 WP_000843419.1.29874 WP_000843419.1.29876 WP_000843419.1.29933 WP_000843419.1.2995 WP_000843419.1.29976 WP_000843419.1.29979 WP_000843419.1.29988 WP_000843419.1.29992 WP_000843419.1.30 WP_000843419.1.30019 WP_000843419.1.30035 WP_000843419.1.30052 WP_000843419.1.30063 WP_000843419.1.30064 WP_000843419.1.30098 WP_000843419.1.30123 WP_000843419.1.30141 WP_000843419.1.30164 WP_000843419.1.3018 WP_000843419.1.30221 WP_000843419.1.30239 WP_000843419.1.30247 WP_000843419.1.30253 WP_000843419.1.30347 WP_000843419.1.30391 WP_000843419.1.30399 WP_000843419.1.30400 WP_000843419.1.30401 WP_000843419.1.30428 WP_000843419.1.3045 WP_000843419.1.30452 WP_000843419.1.30472 WP_000843419.1.30476 WP_000843419.1.30479 WP_000843419.1.30524 WP_000843419.1.30536 WP_000843419.1.30546 WP_000843419.1.3055 WP_000843419.1.30554 WP_000843419.1.30580 WP_000843419.1.3063 WP_000843419.1.30637 WP_000843419.1.30640 WP_000843419.1.30665 WP_000843419.1.30700 WP_000843419.1.30733 WP_000843419.1.30742 WP_000843419.1.30783 WP_000843419.1.30808 WP_000843419.1.3083 WP_000843419.1.30843 WP_000843419.1.30853 WP_000843419.1.30866 WP_000843419.1.30867 WP_000843419.1.30887 WP_000843419.1.30918 WP_000843419.1.30960 WP_000843419.1.30993 WP_000843419.1.30999 WP_000843419.1.31000 WP_000843419.1.31009 WP_000843419.1.31017 WP_000843419.1.31026 WP_000843419.1.31055 WP_000843419.1.31089 WP_000843419.1.31142 WP_000843419.1.31149 WP_000843419.1.31154 WP_000843419.1.312 WP_000843419.1.31252 WP_000843419.1.31295 WP_000843419.1.31319 WP_000843419.1.31340 WP_000843419.1.31347 WP_000843419.1.31353 WP_000843419.1.31357 WP_000843419.1.3140 WP_000843419.1.31401 WP_000843419.1.31419 WP_000843419.1.31422 WP_000843419.1.31429 WP_000843419.1.31431 WP_000843419.1.31434 WP_000843419.1.3147 WP_000843419.1.31482 WP_000843419.1.31511 WP_000843419.1.31518 WP_000843419.1.31521 WP_000843419.1.31527 WP_000843419.1.31542 WP_000843419.1.31557 WP_000843419.1.31575 WP_000843419.1.31596 WP_000843419.1.31618 WP_000843419.1.31625 WP_000843419.1.31639 WP_000843419.1.31679 WP_000843419.1.31681 WP_000843419.1.3169 WP_000843419.1.31696 WP_000843419.1.31709 WP_000843419.1.31715 WP_000843419.1.31736 WP_000843419.1.31740 WP_000843419.1.3176 WP_000843419.1.31801 WP_000843419.1.31803 WP_000843419.1.31809 WP_000843419.1.31835 WP_000843419.1.31860 WP_000843419.1.31866 WP_000843419.1.31898 WP_000843419.1.31899 WP_000843419.1.31903 WP_000843419.1.31924 WP_000843419.1.31937 WP_000843419.1.31956 WP_000843419.1.3201 WP_000843419.1.32020 WP_000843419.1.32021 WP_000843419.1.32030 WP_000843419.1.32037 WP_000843419.1.32049 WP_000843419.1.32063 WP_000843419.1.32078 WP_000843419.1.32089 WP_000843419.1.32091 WP_000843419.1.32094 WP_000843419.1.3212 WP_000843419.1.32138 WP_000843419.1.32142 WP_000843419.1.3215 WP_000843419.1.32173 WP_000843419.1.32184 WP_000843419.1.322 WP_000843419.1.32222 WP_000843419.1.32225 WP_000843419.1.32232 WP_000843419.1.32234 WP_000843419.1.32236 WP_000843419.1.32242 WP_000843419.1.32243 WP_000843419.1.32279 WP_000843419.1.32287 WP_000843419.1.3233 WP_000843419.1.32333 WP_000843419.1.32432 WP_000843419.1.32435 WP_000843419.1.32443 WP_000843419.1.3247 WP_000843419.1.32475 WP_000843419.1.32478 WP_000843419.1.3248 WP_000843419.1.32480 WP_000843419.1.32494 WP_000843419.1.32518 WP_000843419.1.32536 WP_000843419.1.32561 WP_000843419.1.32574 WP_000843419.1.3259 WP_000843419.1.32590 WP_000843419.1.32591 WP_000843419.1.32635 WP_000843419.1.32650 WP_000843419.1.32655 WP_000843419.1.32680 WP_000843419.1.3269 WP_000843419.1.327 WP_000843419.1.32709 WP_000843419.1.32720 WP_000843419.1.32722 WP_000843419.1.32724 WP_000843419.1.32741 WP_000843419.1.32748 WP_000843419.1.32772 WP_000843419.1.32811 WP_000843419.1.32815 WP_000843419.1.32831 WP_000843419.1.32835 WP_000843419.1.32875 WP_000843419.1.32888 WP_000843419.1.32910 WP_000843419.1.32931 WP_000843419.1.32938 WP_000843419.1.32946 WP_000843419.1.3295 WP_000843419.1.32959 WP_000843419.1.32972 WP_000843419.1.32992 WP_000843419.1.32995 WP_000843419.1.33004 WP_000843419.1.33014 WP_000843419.1.33018 WP_000843419.1.33022 WP_000843419.1.33046 WP_000843419.1.33049 WP_000843419.1.33053 WP_000843419.1.33055 WP_000843419.1.33094 WP_000843419.1.33101 WP_000843419.1.33119 WP_000843419.1.33125 WP_000843419.1.33146 WP_000843419.1.33167 WP_000843419.1.33171 WP_000843419.1.33178 WP_000843419.1.33179 WP_000843419.1.33190 WP_000843419.1.33222 WP_000843419.1.3323 WP_000843419.1.33237 WP_000843419.1.33238 WP_000843419.1.33268 WP_000843419.1.33303 WP_000843419.1.33341 WP_000843419.1.33352 WP_000843419.1.33362 WP_000843419.1.33369 WP_000843419.1.33385 WP_000843419.1.334 WP_000843419.1.33410 WP_000843419.1.33413 WP_000843419.1.3344 WP_000843419.1.33476 WP_000843419.1.33512 WP_000843419.1.33525 WP_000843419.1.33526 WP_000843419.1.3354 WP_000843419.1.33561 WP_000843419.1.33584 WP_000843419.1.33595 WP_000843419.1.33631 WP_000843419.1.33638 WP_000843419.1.33648 WP_000843419.1.33667 WP_000843419.1.33680 WP_000843419.1.33736 WP_000843419.1.33745 WP_000843419.1.33751 WP_000843419.1.33780 WP_000843419.1.33823 WP_000843419.1.33853 WP_000843419.1.33854 WP_000843419.1.33914 WP_000843419.1.33948 WP_000843419.1.33973 WP_000843419.1.33974 WP_000843419.1.33979 WP_000843419.1.3398 WP_000843419.1.33981 WP_000843419.1.34003 WP_000843419.1.34032 WP_000843419.1.34094 WP_000843419.1.3411 WP_000843419.1.34117 WP_000843419.1.34121 WP_000843419.1.34122 WP_000843419.1.34130 WP_000843419.1.34144 WP_000843419.1.3415 WP_000843419.1.342 WP_000843419.1.34206 WP_000843419.1.34208 WP_000843419.1.34224 WP_000843419.1.34269 WP_000843419.1.34270 WP_000843419.1.34273 WP_000843419.1.34277 WP_000843419.1.34294 WP_000843419.1.34332 WP_000843419.1.34341 WP_000843419.1.34348 WP_000843419.1.34362 WP_000843419.1.34380 WP_000843419.1.34383 WP_000843419.1.3439 WP_000843419.1.34397 WP_000843419.1.34422 WP_000843419.1.3444 WP_000843419.1.34440 WP_000843419.1.34441 WP_000843419.1.34456 WP_000843419.1.34464 WP_000843419.1.34470 WP_000843419.1.34500 WP_000843419.1.34528 WP_000843419.1.34541 WP_000843419.1.34557 WP_000843419.1.34558 WP_000843419.1.3460 WP_000843419.1.34605 WP_000843419.1.34617 WP_000843419.1.34655 WP_000843419.1.34668 WP_000843419.1.34675 WP_000843419.1.34680 WP_000843419.1.34682 WP_000843419.1.34686 WP_000843419.1.3472 WP_000843419.1.34727 WP_000843419.1.34763 WP_000843419.1.34781 WP_000843419.1.34782 WP_000843419.1.34794 WP_000843419.1.34827 WP_000843419.1.34838 WP_000843419.1.34855 WP_000843419.1.34875 WP_000843419.1.34887 WP_000843419.1.34931 WP_000843419.1.34982 WP_000843419.1.34983 WP_000843419.1.35006 WP_000843419.1.35007 WP_000843419.1.35039 WP_000843419.1.35107 WP_000843419.1.35114 WP_000843419.1.35127 WP_000843419.1.35132 WP_000843419.1.3515 WP_000843419.1.35168 WP_000843419.1.35180 WP_000843419.1.35186 WP_000843419.1.35198 WP_000843419.1.35202 WP_000843419.1.3521 WP_000843419.1.35220 WP_000843419.1.35253 WP_000843419.1.35258 WP_000843419.1.35316 WP_000843419.1.35349 WP_000843419.1.35365 WP_000843419.1.35368 WP_000843419.1.35376 WP_000843419.1.3539 WP_000843419.1.35393 WP_000843419.1.35394 WP_000843419.1.35398 WP_000843419.1.35464 WP_000843419.1.35465 WP_000843419.1.35466 WP_000843419.1.35468 WP_000843419.1.35483 WP_000843419.1.3550 WP_000843419.1.35552 WP_000843419.1.35578 WP_000843419.1.35581 WP_000843419.1.3560 WP_000843419.1.35604 WP_000843419.1.35627 WP_000843419.1.35632 WP_000843419.1.35649 WP_000843419.1.35653 WP_000843419.1.35654 WP_000843419.1.35740 WP_000843419.1.35741 WP_000843419.1.35789 WP_000843419.1.35889 WP_000843419.1.35904 WP_000843419.1.35922 WP_000843419.1.35927 WP_000843419.1.35942 WP_000843419.1.35963 WP_000843419.1.3598 WP_000843419.1.35983 WP_000843419.1.35987 WP_000843419.1.35990 WP_000843419.1.3600 WP_000843419.1.36010 WP_000843419.1.36040 WP_000843419.1.36042 WP_000843419.1.36070 WP_000843419.1.36071 WP_000843419.1.36085 WP_000843419.1.36094 WP_000843419.1.36105 WP_000843419.1.36129 WP_000843419.1.36159 WP_000843419.1.36166 WP_000843419.1.36177 WP_000843419.1.36182 WP_000843419.1.3620 WP_000843419.1.36207 WP_000843419.1.36212 WP_000843419.1.36281 WP_000843419.1.36299 WP_000843419.1.36393 WP_000843419.1.36405 WP_000843419.1.36412 WP_000843419.1.36426 WP_000843419.1.3643 WP_000843419.1.36453 WP_000843419.1.36459 WP_000843419.1.36496 WP_000843419.1.36500 WP_000843419.1.36507 WP_000843419.1.36523 WP_000843419.1.36531 WP_000843419.1.36537 WP_000843419.1.36610 WP_000843419.1.36626 WP_000843419.1.36628 WP_000843419.1.36667 WP_000843419.1.3668 WP_000843419.1.36699 WP_000843419.1.36707 WP_000843419.1.36724 WP_000843419.1.36747 WP_000843419.1.36761 WP_000843419.1.36767 WP_000843419.1.36806 WP_000843419.1.36812 WP_000843419.1.36817 WP_000843419.1.36826 WP_000843419.1.36833 WP_000843419.1.36856 WP_000843419.1.36886 WP_000843419.1.36904 WP_000843419.1.36925 WP_000843419.1.36971 WP_000843419.1.36975 WP_000843419.1.37006 WP_000843419.1.37020 WP_000843419.1.37032 WP_000843419.1.37046 WP_000843419.1.37057 WP_000843419.1.37076 WP_000843419.1.37099 WP_000843419.1.37101 WP_000843419.1.37102 WP_000843419.1.37122 WP_000843419.1.37146 WP_000843419.1.37155 WP_000843419.1.37206 WP_000843419.1.37290 WP_000843419.1.3730 WP_000843419.1.37306 WP_000843419.1.37312 WP_000843419.1.37329 WP_000843419.1.37334 WP_000843419.1.37337 WP_000843419.1.37342 WP_000843419.1.37352 WP_000843419.1.37371 WP_000843419.1.37372 WP_000843419.1.37423 WP_000843419.1.37472 WP_000843419.1.37476 WP_000843419.1.37477 WP_000843419.1.3749 WP_000843419.1.37510 WP_000843419.1.37543 WP_000843419.1.37544 WP_000843419.1.37548 WP_000843419.1.37549 WP_000843419.1.37550 WP_000843419.1.37554 WP_000843419.1.37592 WP_000843419.1.37608 WP_000843419.1.3762 WP_000843419.1.37634 WP_000843419.1.37637 WP_000843419.1.37664 WP_000843419.1.377 WP_000843419.1.3772 WP_000843419.1.37730 WP_000843419.1.37731 WP_000843419.1.37745 WP_000843419.1.37758 WP_000843419.1.37766 WP_000843419.1.37769 WP_000843419.1.37817 WP_000843419.1.37830 WP_000843419.1.37852 WP_000843419.1.37853 WP_000843419.1.3788 WP_000843419.1.37880 WP_000843419.1.37887 WP_000843419.1.37917 WP_000843419.1.37926 WP_000843419.1.37940 WP_000843419.1.3795 WP_000843419.1.37967 WP_000843419.1.37984 WP_000843419.1.37995 WP_000843419.1.37998 WP_000843419.1.38000 WP_000843419.1.38033 WP_000843419.1.38050 WP_000843419.1.38063 WP_000843419.1.38081 WP_000843419.1.38085 WP_000843419.1.38103 WP_000843419.1.38107 WP_000843419.1.38119 WP_000843419.1.38120 WP_000843419.1.3815 WP_000843419.1.38162 WP_000843419.1.38185 WP_000843419.1.38202 WP_000843419.1.38211 WP_000843419.1.3822 WP_000843419.1.38257 WP_000843419.1.38264 WP_000843419.1.38300 WP_000843419.1.38306 WP_000843419.1.38314 WP_000843419.1.38323 WP_000843419.1.38357 WP_000843419.1.38363 WP_000843419.1.38369 WP_000843419.1.38392 WP_000843419.1.38412 WP_000843419.1.38419 WP_000843419.1.38533 WP_000843419.1.38544 WP_000843419.1.38561 WP_000843419.1.38584 WP_000843419.1.38610 WP_000843419.1.38626 WP_000843419.1.38629 WP_000843419.1.38694 WP_000843419.1.38722 WP_000843419.1.3873 WP_000843419.1.38751 WP_000843419.1.38777 WP_000843419.1.38782 WP_000843419.1.38811 WP_000843419.1.38827 WP_000843419.1.38835 WP_000843419.1.38843 WP_000843419.1.38896 WP_000843419.1.389 WP_000843419.1.38911 WP_000843419.1.38920 WP_000843419.1.38935 WP_000843419.1.38937 WP_000843419.1.38958 WP_000843419.1.39005 WP_000843419.1.39015 WP_000843419.1.3903 WP_000843419.1.39037 WP_000843419.1.3904 WP_000843419.1.39042 WP_000843419.1.39063 WP_000843419.1.39103 WP_000843419.1.39111 WP_000843419.1.39123 WP_000843419.1.39148 WP_000843419.1.39150 WP_000843419.1.39155 WP_000843419.1.39157 WP_000843419.1.39171 WP_000843419.1.39180 WP_000843419.1.3921 WP_000843419.1.3922 WP_000843419.1.39232 WP_000843419.1.39249 WP_000843419.1.39268 WP_000843419.1.39286 WP_000843419.1.39289 WP_000843419.1.39302 WP_000843419.1.39305 WP_000843419.1.39310 WP_000843419.1.39313 WP_000843419.1.39325 WP_000843419.1.39335 WP_000843419.1.39342 WP_000843419.1.39358 WP_000843419.1.39367 WP_000843419.1.39373 WP_000843419.1.39401 WP_000843419.1.39415 WP_000843419.1.39468 WP_000843419.1.39481 WP_000843419.1.39509 WP_000843419.1.3954 WP_000843419.1.39541 WP_000843419.1.39564 WP_000843419.1.39575 WP_000843419.1.39580 WP_000843419.1.39601 WP_000843419.1.39606 WP_000843419.1.39607 WP_000843419.1.39610 WP_000843419.1.39626 WP_000843419.1.39636 WP_000843419.1.39646 WP_000843419.1.39651 WP_000843419.1.39690 WP_000843419.1.3970 WP_000843419.1.39708 WP_000843419.1.39713 WP_000843419.1.39715 WP_000843419.1.39730 WP_000843419.1.39733 WP_000843419.1.39734 WP_000843419.1.39758 WP_000843419.1.39796 WP_000843419.1.39809 WP_000843419.1.39818 WP_000843419.1.39822 WP_000843419.1.39867 WP_000843419.1.39892 WP_000843419.1.39966 WP_000843419.1.39970 WP_000843419.1.39998 WP_000843419.1.40013 WP_000843419.1.40019 WP_000843419.1.4005 WP_000843419.1.40083 WP_000843419.1.40088 WP_000843419.1.40107 WP_000843419.1.40113 WP_000843419.1.40121 WP_000843419.1.40147 WP_000843419.1.40153 WP_000843419.1.40159 WP_000843419.1.40183 WP_000843419.1.40190 WP_000843419.1.4020 WP_000843419.1.40206 WP_000843419.1.40234 WP_000843419.1.40249 WP_000843419.1.40298 WP_000843419.1.4030 WP_000843419.1.40300 WP_000843419.1.40315 WP_000843419.1.40319 WP_000843419.1.40335 WP_000843419.1.40345 WP_000843419.1.40349 WP_000843419.1.40360 WP_000843419.1.40382 WP_000843419.1.40391 WP_000843419.1.40403 WP_000843419.1.40486 WP_000843419.1.4049 WP_000843419.1.40502 WP_000843419.1.40509 WP_000843419.1.40539 WP_000843419.1.40549 WP_000843419.1.40560 WP_000843419.1.40563 WP_000843419.1.40596 WP_000843419.1.40599 WP_000843419.1.40607 WP_000843419.1.40617 WP_000843419.1.40623 WP_000843419.1.40629 WP_000843419.1.40636 WP_000843419.1.40657 WP_000843419.1.40660 WP_000843419.1.40666 WP_000843419.1.40668 WP_000843419.1.40686 WP_000843419.1.40712 WP_000843419.1.40715 WP_000843419.1.40758 WP_000843419.1.40793 WP_000843419.1.4081 WP_000843419.1.40813 WP_000843419.1.4082 WP_000843419.1.40833 WP_000843419.1.40842 WP_000843419.1.40843 WP_000843419.1.40865 WP_000843419.1.40882 WP_000843419.1.40893 WP_000843419.1.40900 WP_000843419.1.40952 WP_000843419.1.4103 WP_000843419.1.41037 WP_000843419.1.41041 WP_000843419.1.41045 WP_000843419.1.41060 WP_000843419.1.41063 WP_000843419.1.41078 WP_000843419.1.41113 WP_000843419.1.41125 WP_000843419.1.41147 WP_000843419.1.41230 WP_000843419.1.41239 WP_000843419.1.41244 WP_000843419.1.41259 WP_000843419.1.41263 WP_000843419.1.41271 WP_000843419.1.41287 WP_000843419.1.41294 WP_000843419.1.41315 WP_000843419.1.41330 WP_000843419.1.41332 WP_000843419.1.41339 WP_000843419.1.41346 WP_000843419.1.41363 WP_000843419.1.41371 WP_000843419.1.41372 WP_000843419.1.41391 WP_000843419.1.41392 WP_000843419.1.41394 WP_000843419.1.41401 WP_000843419.1.41402 WP_000843419.1.41407 WP_000843419.1.41417 WP_000843419.1.4142 WP_000843419.1.41449 WP_000843419.1.41453 WP_000843419.1.41455 WP_000843419.1.41457 WP_000843419.1.41466 WP_000843419.1.41478 WP_000843419.1.41481 WP_000843419.1.41482 WP_000843419.1.41484 WP_000843419.1.41488 WP_000843419.1.41513 WP_000843419.1.41536 WP_000843419.1.41539 WP_000843419.1.41545 WP_000843419.1.41566 WP_000843419.1.4158 WP_000843419.1.41606 WP_000843419.1.41613 WP_000843419.1.41621 WP_000843419.1.41651 WP_000843419.1.41654 WP_000843419.1.41718 WP_000843419.1.4172 WP_000843419.1.41734 WP_000843419.1.41740 WP_000843419.1.41741 WP_000843419.1.41752 WP_000843419.1.41780 WP_000843419.1.41783 WP_000843419.1.41784 WP_000843419.1.41809 WP_000843419.1.41812 WP_000843419.1.41813 WP_000843419.1.41826 WP_000843419.1.41849 WP_000843419.1.41885 WP_000843419.1.41988 WP_000843419.1.41990 WP_000843419.1.41991 WP_000843419.1.42027 WP_000843419.1.42033 WP_000843419.1.42036 WP_000843419.1.42038 WP_000843419.1.42044 WP_000843419.1.42060 WP_000843419.1.42095 WP_000843419.1.42096 WP_000843419.1.42113 WP_000843419.1.4213 WP_000843419.1.42138 WP_000843419.1.4214 WP_000843419.1.42151 WP_000843419.1.42159 WP_000843419.1.42203 WP_000843419.1.42214 WP_000843419.1.42226 WP_000843419.1.42228 WP_000843419.1.42233 WP_000843419.1.4224 WP_000843419.1.42252 WP_000843419.1.42277 WP_000843419.1.42284 WP_000843419.1.42300 WP_000843419.1.42318 WP_000843419.1.42359 WP_000843419.1.42367 WP_000843419.1.42369 WP_000843419.1.42387 WP_000843419.1.42415 WP_000843419.1.42442 WP_000843419.1.42443 WP_000843419.1.42447 WP_000843419.1.42480 WP_000843419.1.4250 WP_000843419.1.42513 WP_000843419.1.42516 WP_000843419.1.42522 WP_000843419.1.42586 WP_000843419.1.42594 WP_000843419.1.42597 WP_000843419.1.42600 WP_000843419.1.42601 WP_000843419.1.4261 WP_000843419.1.42632 WP_000843419.1.42638 WP_000843419.1.42661 WP_000843419.1.42669 WP_000843419.1.42677 WP_000843419.1.42709 WP_000843419.1.42728 WP_000843419.1.42748 WP_000843419.1.42749 WP_000843419.1.42750 WP_000843419.1.42761 WP_000843419.1.42771 WP_000843419.1.42791 WP_000843419.1.42813 WP_000843419.1.42828 WP_000843419.1.42830 WP_000843419.1.42832 WP_000843419.1.42863 WP_000843419.1.42891 WP_000843419.1.4290 WP_000843419.1.42918 WP_000843419.1.42950 WP_000843419.1.42962 WP_000843419.1.42966 WP_000843419.1.42970 WP_000843419.1.42975 WP_000843419.1.42987 WP_000843419.1.42989 WP_000843419.1.43013 WP_000843419.1.43027 WP_000843419.1.43079 WP_000843419.1.43121 WP_000843419.1.43123 WP_000843419.1.4313 WP_000843419.1.43133 WP_000843419.1.43137 WP_000843419.1.43140 WP_000843419.1.43166 WP_000843419.1.43170 WP_000843419.1.43177 WP_000843419.1.43196 WP_000843419.1.43239 WP_000843419.1.43278 WP_000843419.1.43316 WP_000843419.1.43324 WP_000843419.1.43363 WP_000843419.1.43374 WP_000843419.1.43384 WP_000843419.1.43389 WP_000843419.1.4342 WP_000843419.1.43427 WP_000843419.1.4343 WP_000843419.1.43444 WP_000843419.1.43448 WP_000843419.1.43455 WP_000843419.1.43469 WP_000843419.1.43474 WP_000843419.1.43501 WP_000843419.1.43536 WP_000843419.1.4356 WP_000843419.1.43561 WP_000843419.1.43566 WP_000843419.1.43598 WP_000843419.1.436 WP_000843419.1.43604 WP_000843419.1.43622 WP_000843419.1.43642 WP_000843419.1.43738 WP_000843419.1.43750 WP_000843419.1.43754 WP_000843419.1.43769 WP_000843419.1.43798 WP_000843419.1.43804 WP_000843419.1.43816 WP_000843419.1.43837 WP_000843419.1.43858 WP_000843419.1.43898 WP_000843419.1.43911 WP_000843419.1.43925 WP_000843419.1.43939 WP_000843419.1.43942 WP_000843419.1.43953 WP_000843419.1.43966 WP_000843419.1.43989 WP_000843419.1.4400 WP_000843419.1.44018 WP_000843419.1.44020 WP_000843419.1.44029 WP_000843419.1.44040 WP_000843419.1.44075 WP_000843419.1.44077 WP_000843419.1.44125 WP_000843419.1.44130 WP_000843419.1.4415 WP_000843419.1.44165 WP_000843419.1.44203 WP_000843419.1.44211 WP_000843419.1.44222 WP_000843419.1.44238 WP_000843419.1.44263 WP_000843419.1.44264 WP_000843419.1.44273 WP_000843419.1.44285 WP_000843419.1.44287 WP_000843419.1.44292 WP_000843419.1.44314 WP_000843419.1.44324 WP_000843419.1.44327 WP_000843419.1.44354 WP_000843419.1.44389 WP_000843419.1.44424 WP_000843419.1.44426 WP_000843419.1.44447 WP_000843419.1.4445 WP_000843419.1.44452 WP_000843419.1.44461 WP_000843419.1.44488 WP_000843419.1.4449 WP_000843419.1.44524 WP_000843419.1.44539 WP_000843419.1.4454 WP_000843419.1.44561 WP_000843419.1.44570 WP_000843419.1.44587 WP_000843419.1.4459 WP_000843419.1.44608 WP_000843419.1.44622 WP_000843419.1.44627 WP_000843419.1.44649 WP_000843419.1.44661 WP_000843419.1.44668 WP_000843419.1.44671 WP_000843419.1.44686 WP_000843419.1.4471 WP_000843419.1.44717 WP_000843419.1.4473 WP_000843419.1.44733 WP_000843419.1.44756 WP_000843419.1.44759 WP_000843419.1.44784 WP_000843419.1.448 WP_000843419.1.44814 WP_000843419.1.44818 WP_000843419.1.44836 WP_000843419.1.44840 WP_000843419.1.44843 WP_000843419.1.44848 WP_000843419.1.44857 WP_000843419.1.44906 WP_000843419.1.44954 WP_000843419.1.44961 WP_000843419.1.44975 WP_000843419.1.44980 WP_000843419.1.45000 WP_000843419.1.45020 WP_000843419.1.45025 WP_000843419.1.45053 WP_000843419.1.45068 WP_000843419.1.45076 WP_000843419.1.45104 WP_000843419.1.45116 WP_000843419.1.45153 WP_000843419.1.45156 WP_000843419.1.45190 WP_000843419.1.45195 WP_000843419.1.4524 WP_000843419.1.45293 WP_000843419.1.4530 WP_000843419.1.45301 WP_000843419.1.45313 WP_000843419.1.4535 WP_000843419.1.45359 WP_000843419.1.4538 WP_000843419.1.45392 WP_000843419.1.45404 WP_000843419.1.45405 WP_000843419.1.45444 WP_000843419.1.45486 WP_000843419.1.4549 WP_000843419.1.45494 WP_000843419.1.45500 WP_000843419.1.45525 WP_000843419.1.45538 WP_000843419.1.45565 WP_000843419.1.45575 WP_000843419.1.45627 WP_000843419.1.4563 WP_000843419.1.45664 WP_000843419.1.45674 WP_000843419.1.45676 WP_000843419.1.4570 WP_000843419.1.45707 WP_000843419.1.45718 WP_000843419.1.45740 WP_000843419.1.45741 WP_000843419.1.45752 WP_000843419.1.4576 WP_000843419.1.45789 WP_000843419.1.45793 WP_000843419.1.45799 WP_000843419.1.45801 WP_000843419.1.4583 WP_000843419.1.45840 WP_000843419.1.45841 WP_000843419.1.45846 WP_000843419.1.45868 WP_000843419.1.45891 WP_000843419.1.45901 WP_000843419.1.45921 WP_000843419.1.45930 WP_000843419.1.45931 WP_000843419.1.45941 WP_000843419.1.45945 WP_000843419.1.45949 WP_000843419.1.45960 WP_000843419.1.45962 WP_000843419.1.45968 WP_000843419.1.45991 WP_000843419.1.4600 WP_000843419.1.46026 WP_000843419.1.46027 WP_000843419.1.46039 WP_000843419.1.46048 WP_000843419.1.46049 WP_000843419.1.46070 WP_000843419.1.46081 WP_000843419.1.46097 WP_000843419.1.4610 WP_000843419.1.46105 WP_000843419.1.46122 WP_000843419.1.4613 WP_000843419.1.46164 WP_000843419.1.4617 WP_000843419.1.4619 WP_000843419.1.46239 WP_000843419.1.46245 WP_000843419.1.46257 WP_000843419.1.46282 WP_000843419.1.46283 WP_000843419.1.46291 WP_000843419.1.46301 WP_000843419.1.46369 WP_000843419.1.46379 WP_000843419.1.46414 WP_000843419.1.46429 WP_000843419.1.4643 WP_000843419.1.46433 WP_000843419.1.46438 WP_000843419.1.46451 WP_000843419.1.4646 WP_000843419.1.46468 WP_000843419.1.4647 WP_000843419.1.46477 WP_000843419.1.46503 WP_000843419.1.46526 WP_000843419.1.46531 WP_000843419.1.46541 WP_000843419.1.46552 WP_000843419.1.46555 WP_000843419.1.4657 WP_000843419.1.46589 WP_000843419.1.46594 WP_000843419.1.46597 WP_000843419.1.46602 WP_000843419.1.46611 WP_000843419.1.46614 WP_000843419.1.46616 WP_000843419.1.46626 WP_000843419.1.46643 WP_000843419.1.46655 WP_000843419.1.46668 WP_000843419.1.4670 WP_000843419.1.46734 WP_000843419.1.46743 WP_000843419.1.46795 WP_000843419.1.46806 WP_000843419.1.46810 WP_000843419.1.46820 WP_000843419.1.46821 WP_000843419.1.46832 WP_000843419.1.46841 WP_000843419.1.46857 WP_000843419.1.46860 WP_000843419.1.46876 WP_000843419.1.46882 WP_000843419.1.46898 WP_000843419.1.4691 WP_000843419.1.46912 WP_000843419.1.46913 WP_000843419.1.46932 WP_000843419.1.46990 WP_000843419.1.46991 WP_000843419.1.46994 WP_000843419.1.46999 WP_000843419.1.47024 WP_000843419.1.47028 WP_000843419.1.47029 WP_000843419.1.47030 WP_000843419.1.47034 WP_000843419.1.47047 WP_000843419.1.47050 WP_000843419.1.47063 WP_000843419.1.47069 WP_000843419.1.47073 WP_000843419.1.4708 WP_000843419.1.47124 WP_000843419.1.47135 WP_000843419.1.47140 WP_000843419.1.47156 WP_000843419.1.47167 WP_000843419.1.47186 WP_000843419.1.47189 WP_000843419.1.47197 WP_000843419.1.47198 WP_000843419.1.4722 WP_000843419.1.47224 WP_000843419.1.4723 WP_000843419.1.47235 WP_000843419.1.47247 WP_000843419.1.4725 WP_000843419.1.47280 WP_000843419.1.47307 WP_000843419.1.47316 WP_000843419.1.47319 WP_000843419.1.47322 WP_000843419.1.47332 WP_000843419.1.47344 WP_000843419.1.47349 WP_000843419.1.47350 WP_000843419.1.47356 WP_000843419.1.47363 WP_000843419.1.47366 WP_000843419.1.47370 WP_000843419.1.47386 WP_000843419.1.4740 WP_000843419.1.47411 WP_000843419.1.47416 WP_000843419.1.47425 WP_000843419.1.4743 WP_000843419.1.47451 WP_000843419.1.47454 WP_000843419.1.47464 WP_000843419.1.47473 WP_000843419.1.47477 WP_000843419.1.47488 WP_000843419.1.47498 WP_000843419.1.47500 WP_000843419.1.47529 WP_000843419.1.47533 WP_000843419.1.47555 WP_000843419.1.47582 WP_000843419.1.47599 WP_000843419.1.47654 WP_000843419.1.47662 WP_000843419.1.47673 WP_000843419.1.47722 WP_000843419.1.4773 WP_000843419.1.47734 WP_000843419.1.47744 WP_000843419.1.47761 WP_000843419.1.47770 WP_000843419.1.47775 WP_000843419.1.47784 WP_000843419.1.47790 WP_000843419.1.47820 WP_000843419.1.47827 WP_000843419.1.4783 WP_000843419.1.47848 WP_000843419.1.4785 WP_000843419.1.47884 WP_000843419.1.47914 WP_000843419.1.47935 WP_000843419.1.47954 WP_000843419.1.4796 WP_000843419.1.47962 WP_000843419.1.47976 WP_000843419.1.47981 WP_000843419.1.47983 WP_000843419.1.47994 WP_000843419.1.48000 WP_000843419.1.48018 WP_000843419.1.48065 WP_000843419.1.48073 WP_000843419.1.48077 WP_000843419.1.48080 WP_000843419.1.48087 WP_000843419.1.48090 WP_000843419.1.4812 WP_000843419.1.48144 WP_000843419.1.48168 WP_000843419.1.48188 WP_000843419.1.48216 WP_000843419.1.48222 WP_000843419.1.48226 WP_000843419.1.48229 WP_000843419.1.48258 WP_000843419.1.4826 WP_000843419.1.48285 WP_000843419.1.48291 WP_000843419.1.48317 WP_000843419.1.48353 WP_000843419.1.48355 WP_000843419.1.48385 WP_000843419.1.48404 WP_000843419.1.48417 WP_000843419.1.48421 WP_000843419.1.48431 WP_000843419.1.48433 WP_000843419.1.48469 WP_000843419.1.48477 WP_000843419.1.48480 WP_000843419.1.48483 WP_000843419.1.48505 WP_000843419.1.48522 WP_000843419.1.4857 WP_000843419.1.48571 WP_000843419.1.48590 WP_000843419.1.48602 WP_000843419.1.48615 WP_000843419.1.48626 WP_000843419.1.48678 WP_000843419.1.48689 WP_000843419.1.48697 WP_000843419.1.48712 WP_000843419.1.48771 WP_000843419.1.48792 WP_000843419.1.48801 WP_000843419.1.48806 WP_000843419.1.48808 WP_000843419.1.48825 WP_000843419.1.48827 WP_000843419.1.48901 WP_000843419.1.48902 WP_000843419.1.48907 WP_000843419.1.48910 WP_000843419.1.4892 WP_000843419.1.48921 WP_000843419.1.48926 WP_000843419.1.48928 WP_000843419.1.48954 WP_000843419.1.48970 WP_000843419.1.49001 WP_000843419.1.49076 WP_000843419.1.49104 WP_000843419.1.49107 WP_000843419.1.49124 WP_000843419.1.49147 WP_000843419.1.49170 WP_000843419.1.49179 WP_000843419.1.49190 WP_000843419.1.49229 WP_000843419.1.49236 WP_000843419.1.49243 WP_000843419.1.49259 WP_000843419.1.49275 WP_000843419.1.4931 WP_000843419.1.49312 WP_000843419.1.49321 WP_000843419.1.49332 WP_000843419.1.49336 WP_000843419.1.49342 WP_000843419.1.49347 WP_000843419.1.49401 WP_000843419.1.49431 WP_000843419.1.49446 WP_000843419.1.49459 WP_000843419.1.49464 WP_000843419.1.49481 WP_000843419.1.49482 WP_000843419.1.49483 WP_000843419.1.4949 WP_000843419.1.49496 WP_000843419.1.49521 WP_000843419.1.49528 WP_000843419.1.4953 WP_000843419.1.49558 WP_000843419.1.49567 WP_000843419.1.49594 WP_000843419.1.49599 WP_000843419.1.49615 WP_000843419.1.49621 WP_000843419.1.49625 WP_000843419.1.49655 WP_000843419.1.49684 WP_000843419.1.49712 WP_000843419.1.49722 WP_000843419.1.49740 WP_000843419.1.49747 WP_000843419.1.49768 WP_000843419.1.49771 WP_000843419.1.49774 WP_000843419.1.49777 WP_000843419.1.49783 WP_000843419.1.49788 WP_000843419.1.49820 WP_000843419.1.49856 WP_000843419.1.49861 WP_000843419.1.49879 WP_000843419.1.49883 WP_000843419.1.49884 WP_000843419.1.49902 WP_000843419.1.49950 WP_000843419.1.49954 WP_000843419.1.49972 WP_000843419.1.49987 WP_000843419.1.5003 WP_000843419.1.50036 WP_000843419.1.50058 WP_000843419.1.50098 WP_000843419.1.50110 WP_000843419.1.50113 WP_000843419.1.50119 WP_000843419.1.50136 WP_000843419.1.50146 WP_000843419.1.50179 WP_000843419.1.50182 WP_000843419.1.50187 WP_000843419.1.50191 WP_000843419.1.50196 WP_000843419.1.50207 WP_000843419.1.50214 WP_000843419.1.50228 WP_000843419.1.50230 WP_000843419.1.50258 WP_000843419.1.50266 WP_000843419.1.50269 WP_000843419.1.50270 WP_000843419.1.50273 WP_000843419.1.50278 WP_000843419.1.50304 WP_000843419.1.50329 WP_000843419.1.50345 WP_000843419.1.50353 WP_000843419.1.50358 WP_000843419.1.50361 WP_000843419.1.50366 WP_000843419.1.5037 WP_000843419.1.50380 WP_000843419.1.50381 WP_000843419.1.5040 WP_000843419.1.5041 WP_000843419.1.50412 WP_000843419.1.50418 WP_000843419.1.50427 WP_000843419.1.50446 WP_000843419.1.5046 WP_000843419.1.50539 WP_000843419.1.50549 WP_000843419.1.50564 WP_000843419.1.50585 WP_000843419.1.50586 WP_000843419.1.506 WP_000843419.1.5061 WP_000843419.1.50616 WP_000843419.1.5064 WP_000843419.1.50690 WP_000843419.1.50700 WP_000843419.1.50715 WP_000843419.1.50717 WP_000843419.1.50725 WP_000843419.1.50762 WP_000843419.1.50936 WP_000843419.1.50939 WP_000843419.1.50947 WP_000843419.1.5095 WP_000843419.1.50969 WP_000843419.1.50986 WP_000843419.1.50988 WP_000843419.1.50990 WP_000843419.1.50993 WP_000843419.1.50996 WP_000843419.1.51013 WP_000843419.1.51027 WP_000843419.1.51058 WP_000843419.1.511 WP_000843419.1.51109 WP_000843419.1.51127 WP_000843419.1.51154 WP_000843419.1.51170 WP_000843419.1.51171 WP_000843419.1.51175 WP_000843419.1.51180 WP_000843419.1.51190 WP_000843419.1.51203 WP_000843419.1.51206 WP_000843419.1.51211 WP_000843419.1.5124 WP_000843419.1.51248 WP_000843419.1.51253 WP_000843419.1.51255 WP_000843419.1.51260 WP_000843419.1.51278 WP_000843419.1.5128 WP_000843419.1.51299 WP_000843419.1.51307 WP_000843419.1.51320 WP_000843419.1.51323 WP_000843419.1.51330 WP_000843419.1.51336 WP_000843419.1.51354 WP_000843419.1.51360 WP_000843419.1.51364 WP_000843419.1.51392 WP_000843419.1.51405 WP_000843419.1.51426 WP_000843419.1.51430 WP_000843419.1.51462 WP_000843419.1.51482 WP_000843419.1.51490 WP_000843419.1.51503 WP_000843419.1.51505 WP_000843419.1.51513 WP_000843419.1.51525 WP_000843419.1.51537 WP_000843419.1.51542 WP_000843419.1.5157 WP_000843419.1.51580 WP_000843419.1.51587 WP_000843419.1.51596 WP_000843419.1.51624 WP_000843419.1.51629 WP_000843419.1.51643 WP_000843419.1.51662 WP_000843419.1.51690 WP_000843419.1.51693 WP_000843419.1.51707 WP_000843419.1.51718 WP_000843419.1.5172 WP_000843419.1.51736 WP_000843419.1.51757 WP_000843419.1.51760 WP_000843419.1.51834 WP_000843419.1.51837 WP_000843419.1.51839 WP_000843419.1.51869 WP_000843419.1.51881 WP_000843419.1.51899 WP_000843419.1.51906 WP_000843419.1.51949 WP_000843419.1.51979 WP_000843419.1.51988 WP_000843419.1.51999 WP_000843419.1.52002 WP_000843419.1.52011 WP_000843419.1.52039 WP_000843419.1.52044 WP_000843419.1.52048 WP_000843419.1.52062 WP_000843419.1.52085 WP_000843419.1.52098 WP_000843419.1.52111 WP_000843419.1.52126 WP_000843419.1.52135 WP_000843419.1.5217 WP_000843419.1.52171 WP_000843419.1.52200 WP_000843419.1.52213 WP_000843419.1.52225 WP_000843419.1.52230 WP_000843419.1.52236 WP_000843419.1.52240 WP_000843419.1.52249 WP_000843419.1.52257 WP_000843419.1.5227 WP_000843419.1.52270 WP_000843419.1.52272 WP_000843419.1.52304 WP_000843419.1.52313 WP_000843419.1.52324 WP_000843419.1.52328 WP_000843419.1.52333 WP_000843419.1.52378 WP_000843419.1.5239 WP_000843419.1.52399 WP_000843419.1.52406 WP_000843419.1.52413 WP_000843419.1.52419 WP_000843419.1.52496 WP_000843419.1.52524 WP_000843419.1.52543 WP_000843419.1.52544 WP_000843419.1.52554 WP_000843419.1.52567 WP_000843419.1.52601 WP_000843419.1.52612 WP_000843419.1.52631 WP_000843419.1.5265 WP_000843419.1.52662 WP_000843419.1.52691 WP_000843419.1.52704 WP_000843419.1.52710 WP_000843419.1.5272 WP_000843419.1.52735 WP_000843419.1.52755 WP_000843419.1.52762 WP_000843419.1.52777 WP_000843419.1.52801 WP_000843419.1.52844 WP_000843419.1.52846 WP_000843419.1.5285 WP_000843419.1.52852 WP_000843419.1.52881 WP_000843419.1.52883 WP_000843419.1.52908 WP_000843419.1.5291 WP_000843419.1.52913 WP_000843419.1.52942 WP_000843419.1.52945 WP_000843419.1.52962 WP_000843419.1.52995 WP_000843419.1.52996 WP_000843419.1.53021 WP_000843419.1.53027 WP_000843419.1.53065 WP_000843419.1.53084 WP_000843419.1.53099 WP_000843419.1.5310 WP_000843419.1.53110 WP_000843419.1.53155 WP_000843419.1.53162 WP_000843419.1.53181 WP_000843419.1.53186 WP_000843419.1.532 WP_000843419.1.53223 WP_000843419.1.53228 WP_000843419.1.53238 WP_000843419.1.53242 WP_000843419.1.53251 WP_000843419.1.53252 WP_000843419.1.53262 WP_000843419.1.53270 WP_000843419.1.53277 WP_000843419.1.53308 WP_000843419.1.53327 WP_000843419.1.53356 WP_000843419.1.53360 WP_000843419.1.53364 WP_000843419.1.53401 WP_000843419.1.53415 WP_000843419.1.53419 WP_000843419.1.5342 WP_000843419.1.53431 WP_000843419.1.53482 WP_000843419.1.53505 WP_000843419.1.5351 WP_000843419.1.53535 WP_000843419.1.53537 WP_000843419.1.53556 WP_000843419.1.53574 WP_000843419.1.53582 WP_000843419.1.53589 WP_000843419.1.53590 WP_000843419.1.53592 WP_000843419.1.5362 WP_000843419.1.53642 WP_000843419.1.53645 WP_000843419.1.53649 WP_000843419.1.53687 WP_000843419.1.53693 WP_000843419.1.53706 WP_000843419.1.53809 WP_000843419.1.53810 WP_000843419.1.53811 WP_000843419.1.53863 WP_000843419.1.53866 WP_000843419.1.53878 WP_000843419.1.53884 WP_000843419.1.5391 WP_000843419.1.5393 WP_000843419.1.53940 WP_000843419.1.5395 WP_000843419.1.53966 WP_000843419.1.53968 WP_000843419.1.53978 WP_000843419.1.54013 WP_000843419.1.54023 WP_000843419.1.54024 WP_000843419.1.54028 WP_000843419.1.54072 WP_000843419.1.54091 WP_000843419.1.54095 WP_000843419.1.54104 WP_000843419.1.54144 WP_000843419.1.54169 WP_000843419.1.54185 WP_000843419.1.54188 WP_000843419.1.54202 WP_000843419.1.54208 WP_000843419.1.54213 WP_000843419.1.54263 WP_000843419.1.54307 WP_000843419.1.54317 WP_000843419.1.54328 WP_000843419.1.54329 WP_000843419.1.5433 WP_000843419.1.5434 WP_000843419.1.54344 WP_000843419.1.54359 WP_000843419.1.5440 WP_000843419.1.5441 WP_000843419.1.54411 WP_000843419.1.54418 WP_000843419.1.54429 WP_000843419.1.54439 WP_000843419.1.54454 WP_000843419.1.54463 WP_000843419.1.54524 WP_000843419.1.54534 WP_000843419.1.54546 WP_000843419.1.54585 WP_000843419.1.54590 WP_000843419.1.54591 WP_000843419.1.5460 WP_000843419.1.54601 WP_000843419.1.5461 WP_000843419.1.54614 WP_000843419.1.54625 WP_000843419.1.54641 WP_000843419.1.54643 WP_000843419.1.5467 WP_000843419.1.54688 WP_000843419.1.54695 WP_000843419.1.5470 WP_000843419.1.54708 WP_000843419.1.54725 WP_000843419.1.54729 WP_000843419.1.54754 WP_000843419.1.54760 WP_000843419.1.54769 WP_000843419.1.5478 WP_000843419.1.5479 WP_000843419.1.54817 WP_000843419.1.54829 WP_000843419.1.5486 WP_000843419.1.54883 WP_000843419.1.54918 WP_000843419.1.54921 WP_000843419.1.54940 WP_000843419.1.54941 WP_000843419.1.54946 WP_000843419.1.54989 WP_000843419.1.54993 WP_000843419.1.55005 WP_000843419.1.55009 WP_000843419.1.55041 WP_000843419.1.55070 WP_000843419.1.55112 WP_000843419.1.55115 WP_000843419.1.55134 WP_000843419.1.55144 WP_000843419.1.55149 WP_000843419.1.55151 WP_000843419.1.55177 WP_000843419.1.55185 WP_000843419.1.55197 WP_000843419.1.5520 WP_000843419.1.55218 WP_000843419.1.55222 WP_000843419.1.55226 WP_000843419.1.55275 WP_000843419.1.55286 WP_000843419.1.55338 WP_000843419.1.55342 WP_000843419.1.55357 WP_000843419.1.55359 WP_000843419.1.55374 WP_000843419.1.55381 WP_000843419.1.55417 WP_000843419.1.55424 WP_000843419.1.55425 WP_000843419.1.55472 WP_000843419.1.55483 WP_000843419.1.55489 WP_000843419.1.55492 WP_000843419.1.55552 WP_000843419.1.55556 WP_000843419.1.55560 WP_000843419.1.55563 WP_000843419.1.55574 WP_000843419.1.55581 WP_000843419.1.55597 WP_000843419.1.55608 WP_000843419.1.5561 WP_000843419.1.5566 WP_000843419.1.55676 WP_000843419.1.5570 WP_000843419.1.55709 WP_000843419.1.55720 WP_000843419.1.55727 WP_000843419.1.55730 WP_000843419.1.55731 WP_000843419.1.55744 WP_000843419.1.55757 WP_000843419.1.55787 WP_000843419.1.55790 WP_000843419.1.55791 WP_000843419.1.55808 WP_000843419.1.55820 WP_000843419.1.55838 WP_000843419.1.55844 WP_000843419.1.55892 WP_000843419.1.55897 WP_000843419.1.55936 WP_000843419.1.55979 WP_000843419.1.55981 WP_000843419.1.55988 WP_000843419.1.55990 WP_000843419.1.56033 WP_000843419.1.56040 WP_000843419.1.56047 WP_000843419.1.56072 WP_000843419.1.561 WP_000843419.1.56101 WP_000843419.1.56122 WP_000843419.1.56139 WP_000843419.1.56142 WP_000843419.1.56149 WP_000843419.1.56151 WP_000843419.1.5616 WP_000843419.1.56169 WP_000843419.1.56177 WP_000843419.1.56193 WP_000843419.1.56216 WP_000843419.1.56231 WP_000843419.1.56278 WP_000843419.1.56293 WP_000843419.1.56302 WP_000843419.1.5632 WP_000843419.1.56338 WP_000843419.1.56345 WP_000843419.1.56358 WP_000843419.1.56371 WP_000843419.1.56388 WP_000843419.1.5639 WP_000843419.1.56390 WP_000843419.1.56392 WP_000843419.1.56399 WP_000843419.1.56402 WP_000843419.1.56436 WP_000843419.1.56439 WP_000843419.1.56446 WP_000843419.1.56457 WP_000843419.1.5646 WP_000843419.1.56469 WP_000843419.1.56481 WP_000843419.1.56489 WP_000843419.1.5649 WP_000843419.1.56491 WP_000843419.1.56501 WP_000843419.1.56513 WP_000843419.1.56528 WP_000843419.1.56543 WP_000843419.1.56554 WP_000843419.1.56571 WP_000843419.1.56573 WP_000843419.1.56586 WP_000843419.1.56662 WP_000843419.1.56665 WP_000843419.1.56680 WP_000843419.1.56689 WP_000843419.1.5670 WP_000843419.1.56713 WP_000843419.1.56714 WP_000843419.1.56721 WP_000843419.1.56742 WP_000843419.1.56776 WP_000843419.1.56777 WP_000843419.1.56787 WP_000843419.1.56789 WP_000843419.1.56799 WP_000843419.1.56821 WP_000843419.1.56830 WP_000843419.1.56835 WP_000843419.1.56871 WP_000843419.1.56882 WP_000843419.1.56908 WP_000843419.1.56933 WP_000843419.1.56936 WP_000843419.1.56937 WP_000843419.1.56941 WP_000843419.1.56951 WP_000843419.1.56978 WP_000843419.1.56980 WP_000843419.1.56992 WP_000843419.1.57011 WP_000843419.1.57032 WP_000843419.1.57051 WP_000843419.1.57068 WP_000843419.1.57071 WP_000843419.1.57072 WP_000843419.1.57079 WP_000843419.1.57086 WP_000843419.1.57100 WP_000843419.1.57124 WP_000843419.1.57150 WP_000843419.1.57180 WP_000843419.1.57182 WP_000843419.1.57185 WP_000843419.1.57197 WP_000843419.1.57202 WP_000843419.1.57213 WP_000843419.1.57216 WP_000843419.1.57222 WP_000843419.1.57254 WP_000843419.1.57269 WP_000843419.1.57278 WP_000843419.1.57280 WP_000843419.1.57281 WP_000843419.1.57319 WP_000843419.1.57348 WP_000843419.1.57349 WP_000843419.1.57386 WP_000843419.1.57401 WP_000843419.1.57403 WP_000843419.1.57438 WP_000843419.1.57451 WP_000843419.1.57453 WP_000843419.1.57466 WP_000843419.1.5748 WP_000843419.1.57487 WP_000843419.1.57492 WP_000843419.1.57517 WP_000843419.1.57538 WP_000843419.1.57539 WP_000843419.1.5755 WP_000843419.1.57550 WP_000843419.1.57558 WP_000843419.1.57574 WP_000843419.1.57588 WP_000843419.1.57608 WP_000843419.1.57610 WP_000843419.1.57628 WP_000843419.1.57629 WP_000843419.1.57634 WP_000843419.1.57638 WP_000843419.1.5764 WP_000843419.1.57646 WP_000843419.1.57659 WP_000843419.1.57669 WP_000843419.1.57738 WP_000843419.1.57812 WP_000843419.1.57832 WP_000843419.1.57836 WP_000843419.1.57851 WP_000843419.1.5786 WP_000843419.1.57898 WP_000843419.1.57903 WP_000843419.1.57951 WP_000843419.1.57975 WP_000843419.1.57983 WP_000843419.1.57994 WP_000843419.1.58001 WP_000843419.1.58022 WP_000843419.1.58045 WP_000843419.1.58048 WP_000843419.1.58057 WP_000843419.1.58094 WP_000843419.1.58098 WP_000843419.1.5810 WP_000843419.1.5812 WP_000843419.1.58128 WP_000843419.1.58136 WP_000843419.1.58143 WP_000843419.1.58146 WP_000843419.1.58163 WP_000843419.1.58169 WP_000843419.1.58172 WP_000843419.1.58206 WP_000843419.1.58226 WP_000843419.1.58233 WP_000843419.1.58238 WP_000843419.1.58248 WP_000843419.1.58267 WP_000843419.1.58289 WP_000843419.1.58316 WP_000843419.1.58340 WP_000843419.1.58345 WP_000843419.1.58368 WP_000843419.1.58371 WP_000843419.1.58384 WP_000843419.1.584 WP_000843419.1.58423 WP_000843419.1.58444 WP_000843419.1.58445 WP_000843419.1.58449 WP_000843419.1.58475 WP_000843419.1.58484 WP_000843419.1.58493 WP_000843419.1.58496 WP_000843419.1.58507 WP_000843419.1.58514 WP_000843419.1.5852 WP_000843419.1.58528 WP_000843419.1.58547 WP_000843419.1.58552 WP_000843419.1.58560 WP_000843419.1.58572 WP_000843419.1.58582 WP_000843419.1.58609 WP_000843419.1.58622 WP_000843419.1.58680 WP_000843419.1.58692 WP_000843419.1.58705 WP_000843419.1.58707 WP_000843419.1.58723 WP_000843419.1.58799 WP_000843419.1.58837 WP_000843419.1.58870 WP_000843419.1.58940 WP_000843419.1.58942 WP_000843419.1.58977 WP_000843419.1.58983 WP_000843419.1.58999 WP_000843419.1.59035 WP_000843419.1.59038 WP_000843419.1.59047 WP_000843419.1.59055 WP_000843419.1.5906 WP_000843419.1.59060 WP_000843419.1.59073 WP_000843419.1.59083 WP_000843419.1.59119 WP_000843419.1.59165 WP_000843419.1.59174 WP_000843419.1.59190 WP_000843419.1.59199 WP_000843419.1.59218 WP_000843419.1.59226 WP_000843419.1.59263 WP_000843419.1.59280 WP_000843419.1.59292 WP_000843419.1.59293 WP_000843419.1.59302 WP_000843419.1.59359 WP_000843419.1.59374 WP_000843419.1.59395 WP_000843419.1.59396 WP_000843419.1.59409 WP_000843419.1.59413 WP_000843419.1.5942 WP_000843419.1.59423 WP_000843419.1.59425 WP_000843419.1.59426 WP_000843419.1.59434 WP_000843419.1.59470 WP_000843419.1.59483 WP_000843419.1.59491 WP_000843419.1.59513 WP_000843419.1.59572 WP_000843419.1.59577 WP_000843419.1.59611 WP_000843419.1.59621 WP_000843419.1.59638 WP_000843419.1.59660 WP_000843419.1.59679 WP_000843419.1.59689 WP_000843419.1.59699 WP_000843419.1.597 WP_000843419.1.59717 WP_000843419.1.59730 WP_000843419.1.59733 WP_000843419.1.59737 WP_000843419.1.59745 WP_000843419.1.59748 WP_000843419.1.59756 WP_000843419.1.59782 WP_000843419.1.59788 WP_000843419.1.59791 WP_000843419.1.59815 WP_000843419.1.59823 WP_000843419.1.59836 WP_000843419.1.59838 WP_000843419.1.59855 WP_000843419.1.59858 WP_000843419.1.59877 WP_000843419.1.5990 WP_000843419.1.59905 WP_000843419.1.59914 WP_000843419.1.59931 WP_000843419.1.59959 WP_000843419.1.59970 WP_000843419.1.59980 WP_000843419.1.59989 WP_000843419.1.60005 WP_000843419.1.60023 WP_000843419.1.60042 WP_000843419.1.60043 WP_000843419.1.60048 WP_000843419.1.60070 WP_000843419.1.60095 WP_000843419.1.60110 WP_000843419.1.60117 WP_000843419.1.6013 WP_000843419.1.60133 WP_000843419.1.60151 WP_000843419.1.60186 WP_000843419.1.6022 WP_000843419.1.60228 WP_000843419.1.60235 WP_000843419.1.60246 WP_000843419.1.60304 WP_000843419.1.60325 WP_000843419.1.60337 WP_000843419.1.60342 WP_000843419.1.60343 WP_000843419.1.60373 WP_000843419.1.60387 WP_000843419.1.60453 WP_000843419.1.60457 WP_000843419.1.60461 WP_000843419.1.60491 WP_000843419.1.60505 WP_000843419.1.60559 WP_000843419.1.60567 WP_000843419.1.60570 WP_000843419.1.60576 WP_000843419.1.6059 WP_000843419.1.60599 WP_000843419.1.60606 WP_000843419.1.60613 WP_000843419.1.60614 WP_000843419.1.6064 WP_000843419.1.60644 WP_000843419.1.60647 WP_000843419.1.60654 WP_000843419.1.60671 WP_000843419.1.6068 WP_000843419.1.60684 WP_000843419.1.60698 WP_000843419.1.60732 WP_000843419.1.60744 WP_000843419.1.60761 WP_000843419.1.60764 WP_000843419.1.60771 WP_000843419.1.60805 WP_000843419.1.60826 WP_000843419.1.60832 WP_000843419.1.60835 WP_000843419.1.60847 WP_000843419.1.60872 WP_000843419.1.60921 WP_000843419.1.60925 WP_000843419.1.60927 WP_000843419.1.60935 WP_000843419.1.6094 WP_000843419.1.60974 WP_000843419.1.61006 WP_000843419.1.61008 WP_000843419.1.61035 WP_000843419.1.61039 WP_000843419.1.61058 WP_000843419.1.6106 WP_000843419.1.61097 WP_000843419.1.61099 WP_000843419.1.6110 WP_000843419.1.61102 WP_000843419.1.61108 WP_000843419.1.61112 WP_000843419.1.61121 WP_000843419.1.61132 WP_000843419.1.61148 WP_000843419.1.61170 WP_000843419.1.61174 WP_000843419.1.61181 WP_000843419.1.61183 WP_000843419.1.61186 WP_000843419.1.61223 WP_000843419.1.61225 WP_000843419.1.61245 WP_000843419.1.61253 WP_000843419.1.61268 WP_000843419.1.61292 WP_000843419.1.61360 WP_000843419.1.61362 WP_000843419.1.61364 WP_000843419.1.61373 WP_000843419.1.61398 WP_000843419.1.61445 WP_000843419.1.61480 WP_000843419.1.61496 WP_000843419.1.615 WP_000843419.1.61505 WP_000843419.1.61512 WP_000843419.1.61524 WP_000843419.1.61551 WP_000843419.1.61608 WP_000843419.1.61612 WP_000843419.1.61623 WP_000843419.1.61636 WP_000843419.1.61643 WP_000843419.1.61703 WP_000843419.1.61718 WP_000843419.1.61758 WP_000843419.1.61770 WP_000843419.1.61772 WP_000843419.1.61789 WP_000843419.1.618 WP_000843419.1.61806 WP_000843419.1.61822 WP_000843419.1.61853 WP_000843419.1.61858 WP_000843419.1.61874 WP_000843419.1.61893 WP_000843419.1.61926 WP_000843419.1.61939 WP_000843419.1.61948 WP_000843419.1.61955 WP_000843419.1.61957 WP_000843419.1.61966 WP_000843419.1.61985 WP_000843419.1.62041 WP_000843419.1.62043 WP_000843419.1.62091 WP_000843419.1.62099 WP_000843419.1.62102 WP_000843419.1.6212 WP_000843419.1.62135 WP_000843419.1.62157 WP_000843419.1.62182 WP_000843419.1.62207 WP_000843419.1.62262 WP_000843419.1.62264 WP_000843419.1.62273 WP_000843419.1.62282 WP_000843419.1.62290 WP_000843419.1.62296 WP_000843419.1.62303 WP_000843419.1.62337 WP_000843419.1.62348 WP_000843419.1.62358 WP_000843419.1.62424 WP_000843419.1.6245 WP_000843419.1.62454 WP_000843419.1.62460 WP_000843419.1.62480 WP_000843419.1.62481 WP_000843419.1.62487 WP_000843419.1.62503 WP_000843419.1.62507 WP_000843419.1.62513 WP_000843419.1.62514 WP_000843419.1.62529 WP_000843419.1.62555 WP_000843419.1.62586 WP_000843419.1.6261 WP_000843419.1.62631 WP_000843419.1.62646 WP_000843419.1.62668 WP_000843419.1.62675 WP_000843419.1.62681 WP_000843419.1.62714 WP_000843419.1.62762 WP_000843419.1.62769 WP_000843419.1.62784 WP_000843419.1.62788 WP_000843419.1.62802 WP_000843419.1.62818 WP_000843419.1.62843 WP_000843419.1.62850 WP_000843419.1.62851 WP_000843419.1.62888 WP_000843419.1.6293 WP_000843419.1.62931 WP_000843419.1.62973 WP_000843419.1.6299 WP_000843419.1.62992 WP_000843419.1.63023 WP_000843419.1.6307 WP_000843419.1.63177 WP_000843419.1.63189 WP_000843419.1.6323 WP_000843419.1.63246 WP_000843419.1.63271 WP_000843419.1.63285 WP_000843419.1.63287 WP_000843419.1.6331 WP_000843419.1.63310 WP_000843419.1.6334 WP_000843419.1.63350 WP_000843419.1.6337 WP_000843419.1.63370 WP_000843419.1.63374 WP_000843419.1.63393 WP_000843419.1.63419 WP_000843419.1.63437 WP_000843419.1.63445 WP_000843419.1.63465 WP_000843419.1.63466 WP_000843419.1.63467 WP_000843419.1.63478 WP_000843419.1.6348 WP_000843419.1.63484 WP_000843419.1.63487 WP_000843419.1.63491 WP_000843419.1.63496 WP_000843419.1.63536 WP_000843419.1.63554 WP_000843419.1.63556 WP_000843419.1.63563 WP_000843419.1.63576 WP_000843419.1.63586 WP_000843419.1.63602 WP_000843419.1.63604 WP_000843419.1.63608 WP_000843419.1.63612 WP_000843419.1.63615 WP_000843419.1.6364 WP_000843419.1.63666 WP_000843419.1.63679 WP_000843419.1.63683 WP_000843419.1.63703 WP_000843419.1.63721 WP_000843419.1.63746 WP_000843419.1.63800 WP_000843419.1.63810 WP_000843419.1.63821 WP_000843419.1.63856 WP_000843419.1.63871 WP_000843419.1.63872 WP_000843419.1.63957 WP_000843419.1.63964 WP_000843419.1.63969 WP_000843419.1.63990 WP_000843419.1.64008 WP_000843419.1.64014 WP_000843419.1.64030 WP_000843419.1.64045 WP_000843419.1.64050 WP_000843419.1.64053 WP_000843419.1.64074 WP_000843419.1.64086 WP_000843419.1.64138 WP_000843419.1.64150 WP_000843419.1.64153 WP_000843419.1.64161 WP_000843419.1.64165 WP_000843419.1.64175 WP_000843419.1.64180 WP_000843419.1.64190 WP_000843419.1.64193 WP_000843419.1.64280 WP_000843419.1.64286 WP_000843419.1.643 WP_000843419.1.6431 WP_000843419.1.64321 WP_000843419.1.64337 WP_000843419.1.64353 WP_000843419.1.64355 WP_000843419.1.64356 WP_000843419.1.64371 WP_000843419.1.64380 WP_000843419.1.64391 WP_000843419.1.6441 WP_000843419.1.64417 WP_000843419.1.64437 WP_000843419.1.64438 WP_000843419.1.6445 WP_000843419.1.64458 WP_000843419.1.6446 WP_000843419.1.64519 WP_000843419.1.64520 WP_000843419.1.64528 WP_000843419.1.64540 WP_000843419.1.64547 WP_000843419.1.64563 WP_000843419.1.64621 WP_000843419.1.64634 WP_000843419.1.64657 WP_000843419.1.64670 WP_000843419.1.6469 WP_000843419.1.64693 WP_000843419.1.64695 WP_000843419.1.647 WP_000843419.1.64707 WP_000843419.1.64712 WP_000843419.1.64746 WP_000843419.1.64749 WP_000843419.1.64784 WP_000843419.1.64793 WP_000843419.1.64821 WP_000843419.1.64840 WP_000843419.1.64866 WP_000843419.1.64881 WP_000843419.1.64895 WP_000843419.1.64901 WP_000843419.1.64926 WP_000843419.1.64930 WP_000843419.1.64939 WP_000843419.1.64946 WP_000843419.1.64970 WP_000843419.1.6499 WP_000843419.1.6500 WP_000843419.1.65023 WP_000843419.1.65035 WP_000843419.1.65056 WP_000843419.1.65061 WP_000843419.1.65084 WP_000843419.1.65097 WP_000843419.1.651 WP_000843419.1.65104 WP_000843419.1.6511 WP_000843419.1.65110 WP_000843419.1.65114 WP_000843419.1.65116 WP_000843419.1.65118 WP_000843419.1.65122 WP_000843419.1.65135 WP_000843419.1.65151 WP_000843419.1.65155 WP_000843419.1.6516 WP_000843419.1.65179 WP_000843419.1.65192 WP_000843419.1.65194 WP_000843419.1.65206 WP_000843419.1.6527 WP_000843419.1.65286 WP_000843419.1.65296 WP_000843419.1.65306 WP_000843419.1.6537 WP_000843419.1.65370 WP_000843419.1.65372 WP_000843419.1.654 WP_000843419.1.65408 WP_000843419.1.65413 WP_000843419.1.65415 WP_000843419.1.65484 WP_000843419.1.6553 WP_000843419.1.65531 WP_000843419.1.65546 WP_000843419.1.65571 WP_000843419.1.65581 WP_000843419.1.65596 WP_000843419.1.65606 WP_000843419.1.6563 WP_000843419.1.65662 WP_000843419.1.65667 WP_000843419.1.65672 WP_000843419.1.65677 WP_000843419.1.65708 WP_000843419.1.65714 WP_000843419.1.65749 WP_000843419.1.65762 WP_000843419.1.6587 WP_000843419.1.65875 WP_000843419.1.65898 WP_000843419.1.65912 WP_000843419.1.65954 WP_000843419.1.65957 WP_000843419.1.65962 WP_000843419.1.65963 WP_000843419.1.65976 WP_000843419.1.65978 WP_000843419.1.65988 WP_000843419.1.6599 WP_000843419.1.65991 WP_000843419.1.66001 WP_000843419.1.66007 WP_000843419.1.66016 WP_000843419.1.66017 WP_000843419.1.66022 WP_000843419.1.66033 WP_000843419.1.6604 WP_000843419.1.66044 WP_000843419.1.66050 WP_000843419.1.66059 WP_000843419.1.6609 WP_000843419.1.66094 WP_000843419.1.66100 WP_000843419.1.66102 WP_000843419.1.66105 WP_000843419.1.66121 WP_000843419.1.66127 WP_000843419.1.6618 WP_000843419.1.66181 WP_000843419.1.66187 WP_000843419.1.66197 WP_000843419.1.6622 WP_000843419.1.66264 WP_000843419.1.66288 WP_000843419.1.66290 WP_000843419.1.66295 WP_000843419.1.66327 WP_000843419.1.66335 WP_000843419.1.66376 WP_000843419.1.66412 WP_000843419.1.66432 WP_000843419.1.66448 WP_000843419.1.6645 WP_000843419.1.66511 WP_000843419.1.66531 WP_000843419.1.66550 WP_000843419.1.66566 WP_000843419.1.66579 WP_000843419.1.66624 WP_000843419.1.66644 WP_000843419.1.6666 WP_000843419.1.66667 WP_000843419.1.66706 WP_000843419.1.66727 WP_000843419.1.66758 WP_000843419.1.6676 WP_000843419.1.66783 WP_000843419.1.66791 WP_000843419.1.66794 WP_000843419.1.66795 WP_000843419.1.66796 WP_000843419.1.66873 WP_000843419.1.66922 WP_000843419.1.66926 WP_000843419.1.66948 WP_000843419.1.66975 WP_000843419.1.66978 WP_000843419.1.6698 WP_000843419.1.6701 WP_000843419.1.67018 WP_000843419.1.67021 WP_000843419.1.67026 WP_000843419.1.67035 WP_000843419.1.6706 WP_000843419.1.67073 WP_000843419.1.67102 WP_000843419.1.67120 WP_000843419.1.67132 WP_000843419.1.67136 WP_000843419.1.67137 WP_000843419.1.67149 WP_000843419.1.67150 WP_000843419.1.67153 WP_000843419.1.67158 WP_000843419.1.67164 WP_000843419.1.67174 WP_000843419.1.67193 WP_000843419.1.67194 WP_000843419.1.67209 WP_000843419.1.67210 WP_000843419.1.67214 WP_000843419.1.6723 WP_000843419.1.67258 WP_000843419.1.67272 WP_000843419.1.67278 WP_000843419.1.67293 WP_000843419.1.6735 WP_000843419.1.67383 WP_000843419.1.67412 WP_000843419.1.67427 WP_000843419.1.67446 WP_000843419.1.67451 WP_000843419.1.67452 WP_000843419.1.67454 WP_000843419.1.67462 WP_000843419.1.67464 WP_000843419.1.67467 WP_000843419.1.67522 WP_000843419.1.67533 WP_000843419.1.67549 WP_000843419.1.67581 WP_000843419.1.67606 WP_000843419.1.67660 WP_000843419.1.67663 WP_000843419.1.67669 WP_000843419.1.67676 WP_000843419.1.67681 WP_000843419.1.67685 WP_000843419.1.6769 WP_000843419.1.67690 WP_000843419.1.67701 WP_000843419.1.67704 WP_000843419.1.67724 WP_000843419.1.67726 WP_000843419.1.67732 WP_000843419.1.67737 WP_000843419.1.67753 WP_000843419.1.67758 WP_000843419.1.67760 WP_000843419.1.67775 WP_000843419.1.67780 WP_000843419.1.67787 WP_000843419.1.67788 WP_000843419.1.678 WP_000843419.1.67802 WP_000843419.1.67810 WP_000843419.1.67841 WP_000843419.1.67861 WP_000843419.1.67901 WP_000843419.1.6793 WP_000843419.1.67938 WP_000843419.1.67984 WP_000843419.1.67990 WP_000843419.1.67992 WP_000843419.1.67999 WP_000843419.1.68011 WP_000843419.1.68012 WP_000843419.1.6802 WP_000843419.1.68025 WP_000843419.1.68039 WP_000843419.1.68052 WP_000843419.1.68053 WP_000843419.1.68059 WP_000843419.1.68069 WP_000843419.1.68070 WP_000843419.1.68079 WP_000843419.1.68096 WP_000843419.1.68108 WP_000843419.1.68126 WP_000843419.1.68138 WP_000843419.1.68145 WP_000843419.1.68157 WP_000843419.1.68175 WP_000843419.1.68177 WP_000843419.1.682 WP_000843419.1.68200 WP_000843419.1.68241 WP_000843419.1.68255 WP_000843419.1.68271 WP_000843419.1.68278 WP_000843419.1.68279 WP_000843419.1.68281 WP_000843419.1.68292 WP_000843419.1.68300 WP_000843419.1.68336 WP_000843419.1.68347 WP_000843419.1.68362 WP_000843419.1.68369 WP_000843419.1.68372 WP_000843419.1.68396 WP_000843419.1.68411 WP_000843419.1.68441 WP_000843419.1.68442 WP_000843419.1.68482 WP_000843419.1.68490 WP_000843419.1.68493 WP_000843419.1.68523 WP_000843419.1.68524 WP_000843419.1.68534 WP_000843419.1.68566 WP_000843419.1.68572 WP_000843419.1.68584 WP_000843419.1.68598 WP_000843419.1.68609 WP_000843419.1.68630 WP_000843419.1.68632 WP_000843419.1.68635 WP_000843419.1.68673 WP_000843419.1.68678 WP_000843419.1.68679 WP_000843419.1.68695 WP_000843419.1.68701 WP_000843419.1.68731 WP_000843419.1.68751 WP_000843419.1.68752 WP_000843419.1.68793 WP_000843419.1.68795 WP_000843419.1.6880 WP_000843419.1.68801 WP_000843419.1.68847 WP_000843419.1.6887 WP_000843419.1.68873 WP_000843419.1.68880 WP_000843419.1.68915 WP_000843419.1.68924 WP_000843419.1.68936 WP_000843419.1.68952 WP_000843419.1.68956 WP_000843419.1.68961 WP_000843419.1.6897 WP_000843419.1.68995 WP_000843419.1.69033 WP_000843419.1.69039 WP_000843419.1.69098 WP_000843419.1.69126 WP_000843419.1.69127 WP_000843419.1.69144 WP_000843419.1.69160 WP_000843419.1.6919 WP_000843419.1.69192 WP_000843419.1.6921 WP_000843419.1.69221 WP_000843419.1.6923 WP_000843419.1.69258 WP_000843419.1.6929 WP_000843419.1.69341 WP_000843419.1.69350 WP_000843419.1.69351 WP_000843419.1.69382 WP_000843419.1.69390 WP_000843419.1.694 WP_000843419.1.69404 WP_000843419.1.69438 WP_000843419.1.69441 WP_000843419.1.69450 WP_000843419.1.69472 WP_000843419.1.69537 WP_000843419.1.69551 WP_000843419.1.69569 WP_000843419.1.69589 WP_000843419.1.69593 WP_000843419.1.69596 WP_000843419.1.69643 WP_000843419.1.69649 WP_000843419.1.69655 WP_000843419.1.69689 WP_000843419.1.697 WP_000843419.1.69716 WP_000843419.1.69730 WP_000843419.1.69780 WP_000843419.1.69786 WP_000843419.1.69810 WP_000843419.1.69818 WP_000843419.1.69831 WP_000843419.1.69832 WP_000843419.1.69868 WP_000843419.1.69872 WP_000843419.1.69887 WP_000843419.1.69896 WP_000843419.1.6993 WP_000843419.1.69963 WP_000843419.1.69972 WP_000843419.1.69979 WP_000843419.1.7001 WP_000843419.1.70041 WP_000843419.1.70063 WP_000843419.1.70081 WP_000843419.1.701 WP_000843419.1.70123 WP_000843419.1.70125 WP_000843419.1.70149 WP_000843419.1.7015 WP_000843419.1.70190 WP_000843419.1.70191 WP_000843419.1.70200 WP_000843419.1.70213 WP_000843419.1.70230 WP_000843419.1.70251 WP_000843419.1.70341 WP_000843419.1.70357 WP_000843419.1.70370 WP_000843419.1.70414 WP_000843419.1.70477 WP_000843419.1.70492 WP_000843419.1.7050 WP_000843419.1.70517 WP_000843419.1.7052 WP_000843419.1.70530 WP_000843419.1.70539 WP_000843419.1.70576 WP_000843419.1.70582 WP_000843419.1.70592 WP_000843419.1.70597 WP_000843419.1.70600 WP_000843419.1.70619 WP_000843419.1.70628 WP_000843419.1.70656 WP_000843419.1.70686 WP_000843419.1.70694 WP_000843419.1.70698 WP_000843419.1.70705 WP_000843419.1.70713 WP_000843419.1.70723 WP_000843419.1.70728 WP_000843419.1.70747 WP_000843419.1.70748 WP_000843419.1.70767 WP_000843419.1.70787 WP_000843419.1.70801 WP_000843419.1.70896 WP_000843419.1.7090 WP_000843419.1.70900 WP_000843419.1.70952 WP_000843419.1.70967 WP_000843419.1.71003 WP_000843419.1.7102 WP_000843419.1.71037 WP_000843419.1.71042 WP_000843419.1.71062 WP_000843419.1.71099 WP_000843419.1.71109 WP_000843419.1.71113 WP_000843419.1.71134 WP_000843419.1.71139 WP_000843419.1.71147 WP_000843419.1.71149 WP_000843419.1.71158 WP_000843419.1.71170 WP_000843419.1.71176 WP_000843419.1.71183 WP_000843419.1.71192 WP_000843419.1.71205 WP_000843419.1.7121 WP_000843419.1.71221 WP_000843419.1.71223 WP_000843419.1.71225 WP_000843419.1.71226 WP_000843419.1.71229 WP_000843419.1.71264 WP_000843419.1.71269 WP_000843419.1.71273 WP_000843419.1.71275 WP_000843419.1.71285 WP_000843419.1.71287 WP_000843419.1.71294 WP_000843419.1.71311 WP_000843419.1.71312 WP_000843419.1.71327 WP_000843419.1.71339 WP_000843419.1.71354 WP_000843419.1.71409 WP_000843419.1.71421 WP_000843419.1.71423 WP_000843419.1.71448 WP_000843419.1.7147 WP_000843419.1.71480 WP_000843419.1.71537 WP_000843419.1.71540 WP_000843419.1.71560 WP_000843419.1.71563 WP_000843419.1.71603 WP_000843419.1.71680 WP_000843419.1.71695 WP_000843419.1.71712 WP_000843419.1.71724 WP_000843419.1.71732 WP_000843419.1.71757 WP_000843419.1.71767 WP_000843419.1.71830 WP_000843419.1.71832 WP_000843419.1.71840 WP_000843419.1.71855 WP_000843419.1.71856 WP_000843419.1.71874 WP_000843419.1.71912 WP_000843419.1.7192 WP_000843419.1.71922 WP_000843419.1.71939 WP_000843419.1.71940 WP_000843419.1.71945 WP_000843419.1.71967 WP_000843419.1.71987 WP_000843419.1.72013 WP_000843419.1.72021 WP_000843419.1.72028 WP_000843419.1.72033 WP_000843419.1.7205 WP_000843419.1.72053 WP_000843419.1.72054 WP_000843419.1.72066 WP_000843419.1.72090 WP_000843419.1.72098 WP_000843419.1.72117 WP_000843419.1.72120 WP_000843419.1.72126 WP_000843419.1.72141 WP_000843419.1.72153 WP_000843419.1.72155 WP_000843419.1.72161 WP_000843419.1.72162 WP_000843419.1.72180 WP_000843419.1.72184 WP_000843419.1.72186 WP_000843419.1.72208 WP_000843419.1.72212 WP_000843419.1.72237 WP_000843419.1.72240 WP_000843419.1.72248 WP_000843419.1.7225 WP_000843419.1.72261 WP_000843419.1.72262 WP_000843419.1.72270 WP_000843419.1.72293 WP_000843419.1.723 WP_000843419.1.72316 WP_000843419.1.72322 WP_000843419.1.72342 WP_000843419.1.72359 WP_000843419.1.72362 WP_000843419.1.72388 WP_000843419.1.72391 WP_000843419.1.72392 WP_000843419.1.72414 WP_000843419.1.72425 WP_000843419.1.72427 WP_000843419.1.72449 WP_000843419.1.72469 WP_000843419.1.72493 WP_000843419.1.72507 WP_000843419.1.72511 WP_000843419.1.72521 WP_000843419.1.72522 WP_000843419.1.72535 WP_000843419.1.72544 WP_000843419.1.72551 WP_000843419.1.72574 WP_000843419.1.72582 WP_000843419.1.72593 WP_000843419.1.72599 WP_000843419.1.72606 WP_000843419.1.72608 WP_000843419.1.72614 WP_000843419.1.72615 WP_000843419.1.72619 WP_000843419.1.72641 WP_000843419.1.72643 WP_000843419.1.72651 WP_000843419.1.72652 WP_000843419.1.72663 WP_000843419.1.72694 WP_000843419.1.72695 WP_000843419.1.72698 WP_000843419.1.72700 WP_000843419.1.72725 WP_000843419.1.72729 WP_000843419.1.72738 WP_000843419.1.72748 WP_000843419.1.72751 WP_000843419.1.72758 WP_000843419.1.72764 WP_000843419.1.7277 WP_000843419.1.72778 WP_000843419.1.72804 WP_000843419.1.72806 WP_000843419.1.7281 WP_000843419.1.72837 WP_000843419.1.72858 WP_000843419.1.72893 WP_000843419.1.7291 WP_000843419.1.72913 WP_000843419.1.72950 WP_000843419.1.72956 WP_000843419.1.72998 WP_000843419.1.73015 WP_000843419.1.73032 WP_000843419.1.73039 WP_000843419.1.73061 WP_000843419.1.7307 WP_000843419.1.73072 WP_000843419.1.73075 WP_000843419.1.73094 WP_000843419.1.73126 WP_000843419.1.73129 WP_000843419.1.73197 WP_000843419.1.73215 WP_000843419.1.73230 WP_000843419.1.73239 WP_000843419.1.73243 WP_000843419.1.73249 WP_000843419.1.73251 WP_000843419.1.73257 WP_000843419.1.73259 WP_000843419.1.73277 WP_000843419.1.73278 WP_000843419.1.73283 WP_000843419.1.73291 WP_000843419.1.73326 WP_000843419.1.73340 WP_000843419.1.73343 WP_000843419.1.73344 WP_000843419.1.73349 WP_000843419.1.73393 WP_000843419.1.73430 WP_000843419.1.7345 WP_000843419.1.73468 WP_000843419.1.73486 WP_000843419.1.7349 WP_000843419.1.73498 WP_000843419.1.73524 WP_000843419.1.73592 WP_000843419.1.73626 WP_000843419.1.73631 WP_000843419.1.73652 WP_000843419.1.73663 WP_000843419.1.73700 WP_000843419.1.73709 WP_000843419.1.73743 WP_000843419.1.73748 WP_000843419.1.7376 WP_000843419.1.73783 WP_000843419.1.73785 WP_000843419.1.73797 WP_000843419.1.73801 WP_000843419.1.73807 WP_000843419.1.73811 WP_000843419.1.73827 WP_000843419.1.73843 WP_000843419.1.73844 WP_000843419.1.73846 WP_000843419.1.73882 WP_000843419.1.73897 WP_000843419.1.73908 WP_000843419.1.7392 WP_000843419.1.73934 WP_000843419.1.73968 WP_000843419.1.73980 WP_000843419.1.73992 WP_000843419.1.73995 WP_000843419.1.73996 WP_000843419.1.74032 WP_000843419.1.74041 WP_000843419.1.74045 WP_000843419.1.74046 WP_000843419.1.74051 WP_000843419.1.74053 WP_000843419.1.74123 WP_000843419.1.7413 WP_000843419.1.74156 WP_000843419.1.74184 WP_000843419.1.74213 WP_000843419.1.74223 WP_000843419.1.7424 WP_000843419.1.7425 WP_000843419.1.74251 WP_000843419.1.74267 WP_000843419.1.7429 WP_000843419.1.74294 WP_000843419.1.74367 WP_000843419.1.74423 WP_000843419.1.74431 WP_000843419.1.74444 WP_000843419.1.74445 WP_000843419.1.7446 WP_000843419.1.74465 WP_000843419.1.74478 WP_000843419.1.74491 WP_000843419.1.74501 WP_000843419.1.74509 WP_000843419.1.74513 WP_000843419.1.74520 WP_000843419.1.74521 WP_000843419.1.74532 WP_000843419.1.74536 WP_000843419.1.74549 WP_000843419.1.74557 WP_000843419.1.74611 WP_000843419.1.74624 WP_000843419.1.74652 WP_000843419.1.74670 WP_000843419.1.74682 WP_000843419.1.74687 WP_000843419.1.74689 WP_000843419.1.74705 WP_000843419.1.7471 WP_000843419.1.74713 WP_000843419.1.74716 WP_000843419.1.74720 WP_000843419.1.74735 WP_000843419.1.74752 WP_000843419.1.74765 WP_000843419.1.7478 WP_000843419.1.7479 WP_000843419.1.74793 WP_000843419.1.74811 WP_000843419.1.74828 WP_000843419.1.74844 WP_000843419.1.74852 WP_000843419.1.74854 WP_000843419.1.74860 WP_000843419.1.74867 WP_000843419.1.74873 WP_000843419.1.74879 WP_000843419.1.74880 WP_000843419.1.74885 WP_000843419.1.74889 WP_000843419.1.74895 WP_000843419.1.74904 WP_000843419.1.74914 WP_000843419.1.74915 WP_000843419.1.74975 WP_000843419.1.74993 WP_000843419.1.75003 WP_000843419.1.75021 WP_000843419.1.75029 WP_000843419.1.75030 WP_000843419.1.75050 WP_000843419.1.75100 WP_000843419.1.75112 WP_000843419.1.75118 WP_000843419.1.75124 WP_000843419.1.75136 WP_000843419.1.75138 WP_000843419.1.75139 WP_000843419.1.75143 WP_000843419.1.75149 WP_000843419.1.7516 WP_000843419.1.75164 WP_000843419.1.75181 WP_000843419.1.75209 WP_000843419.1.75218 WP_000843419.1.75219 WP_000843419.1.75221 WP_000843419.1.75247 WP_000843419.1.75248 WP_000843419.1.75254 WP_000843419.1.75270 WP_000843419.1.75306 WP_000843419.1.7536 WP_000843419.1.75360 WP_000843419.1.75382 WP_000843419.1.7539 WP_000843419.1.75419 WP_000843419.1.75435 WP_000843419.1.75465 WP_000843419.1.75505 WP_000843419.1.75507 WP_000843419.1.75515 WP_000843419.1.75529 WP_000843419.1.75536 WP_000843419.1.75568 WP_000843419.1.75577 WP_000843419.1.75588 WP_000843419.1.75594 WP_000843419.1.75602 WP_000843419.1.75629 WP_000843419.1.75653 WP_000843419.1.75676 WP_000843419.1.75687 WP_000843419.1.75694 WP_000843419.1.75696 WP_000843419.1.75698 WP_000843419.1.75725 WP_000843419.1.75735 WP_000843419.1.75758 WP_000843419.1.75767 WP_000843419.1.75786 WP_000843419.1.75803 WP_000843419.1.75808 WP_000843419.1.7583 WP_000843419.1.75853 WP_000843419.1.75918 WP_000843419.1.75922 WP_000843419.1.7597 WP_000843419.1.75973 WP_000843419.1.75983 WP_000843419.1.75989 WP_000843419.1.75999 WP_000843419.1.76009 WP_000843419.1.76019 WP_000843419.1.76030 WP_000843419.1.76054 WP_000843419.1.7608 WP_000843419.1.76087 WP_000843419.1.76089 WP_000843419.1.76118 WP_000843419.1.76129 WP_000843419.1.7613 WP_000843419.1.76152 WP_000843419.1.7617 WP_000843419.1.76184 WP_000843419.1.76189 WP_000843419.1.76237 WP_000843419.1.76268 WP_000843419.1.76269 WP_000843419.1.76305 WP_000843419.1.7637 WP_000843419.1.76376 WP_000843419.1.76384 WP_000843419.1.76387 WP_000843419.1.76390 WP_000843419.1.76407 WP_000843419.1.76447 WP_000843419.1.76448 WP_000843419.1.76452 WP_000843419.1.76460 WP_000843419.1.76466 WP_000843419.1.76477 WP_000843419.1.76504 WP_000843419.1.76542 WP_000843419.1.76544 WP_000843419.1.76562 WP_000843419.1.76595 WP_000843419.1.7661 WP_000843419.1.76612 WP_000843419.1.76619 WP_000843419.1.76656 WP_000843419.1.76660 WP_000843419.1.76697 WP_000843419.1.76705 WP_000843419.1.76751 WP_000843419.1.76827 WP_000843419.1.76831 WP_000843419.1.76840 WP_000843419.1.76863 WP_000843419.1.76884 WP_000843419.1.76918 WP_000843419.1.76933 WP_000843419.1.76957 WP_000843419.1.76961 WP_000843419.1.76965 WP_000843419.1.76966 WP_000843419.1.77015 WP_000843419.1.77022 WP_000843419.1.77036 WP_000843419.1.77042 WP_000843419.1.77070 WP_000843419.1.771 WP_000843419.1.77109 WP_000843419.1.77120 WP_000843419.1.77128 WP_000843419.1.77134 WP_000843419.1.77147 WP_000843419.1.77162 WP_000843419.1.77163 WP_000843419.1.77173 WP_000843419.1.77198 WP_000843419.1.77200 WP_000843419.1.77204 WP_000843419.1.77224 WP_000843419.1.77239 WP_000843419.1.77253 WP_000843419.1.77255 WP_000843419.1.77258 WP_000843419.1.77275 WP_000843419.1.7728 WP_000843419.1.77284 WP_000843419.1.77288 WP_000843419.1.77290 WP_000843419.1.77291 WP_000843419.1.7731 WP_000843419.1.77320 WP_000843419.1.77326 WP_000843419.1.77341 WP_000843419.1.77391 WP_000843419.1.77392 WP_000843419.1.77432 WP_000843419.1.77437 WP_000843419.1.77448 WP_000843419.1.77452 WP_000843419.1.77462 WP_000843419.1.77470 WP_000843419.1.77471 WP_000843419.1.77477 WP_000843419.1.77487 WP_000843419.1.775 WP_000843419.1.77503 WP_000843419.1.77542 WP_000843419.1.77551 WP_000843419.1.77577 WP_000843419.1.77581 WP_000843419.1.77600 WP_000843419.1.77608 WP_000843419.1.77626 WP_000843419.1.77632 WP_000843419.1.77643 WP_000843419.1.77644 WP_000843419.1.77657 WP_000843419.1.77707 WP_000843419.1.77725 WP_000843419.1.77741 WP_000843419.1.7775 WP_000843419.1.77760 WP_000843419.1.77767 WP_000843419.1.7780 WP_000843419.1.7781 WP_000843419.1.77813 WP_000843419.1.77816 WP_000843419.1.77826 WP_000843419.1.77833 WP_000843419.1.77929 WP_000843419.1.77949 WP_000843419.1.7795 WP_000843419.1.77961 WP_000843419.1.77979 WP_000843419.1.7799 WP_000843419.1.77999 WP_000843419.1.78007 WP_000843419.1.78010 WP_000843419.1.7804 WP_000843419.1.78041 WP_000843419.1.78059 WP_000843419.1.7806 WP_000843419.1.7808 WP_000843419.1.78097 WP_000843419.1.78099 WP_000843419.1.78101 WP_000843419.1.78102 WP_000843419.1.78183 WP_000843419.1.78202 WP_000843419.1.78232 WP_000843419.1.78233 WP_000843419.1.78235 WP_000843419.1.78297 WP_000843419.1.78305 WP_000843419.1.78323 WP_000843419.1.78337 WP_000843419.1.78340 WP_000843419.1.78368 WP_000843419.1.78376 WP_000843419.1.78377 WP_000843419.1.78390 WP_000843419.1.784 WP_000843419.1.78413 WP_000843419.1.78445 WP_000843419.1.78462 WP_000843419.1.78477 WP_000843419.1.78481 WP_000843419.1.78491 WP_000843419.1.7851 WP_000843419.1.78512 WP_000843419.1.78515 WP_000843419.1.7855 WP_000843419.1.78553 WP_000843419.1.78575 WP_000843419.1.78581 WP_000843419.1.78586 WP_000843419.1.78593 WP_000843419.1.78610 WP_000843419.1.78611 WP_000843419.1.78615 WP_000843419.1.78622 WP_000843419.1.78645 WP_000843419.1.78683 WP_000843419.1.78689 WP_000843419.1.78696 WP_000843419.1.78698 WP_000843419.1.78714 WP_000843419.1.78718 WP_000843419.1.78746 WP_000843419.1.78757 WP_000843419.1.78775 WP_000843419.1.78814 WP_000843419.1.7883 WP_000843419.1.78843 WP_000843419.1.78845 WP_000843419.1.78854 WP_000843419.1.78888 WP_000843419.1.78891 WP_000843419.1.78893 WP_000843419.1.78908 WP_000843419.1.78919 WP_000843419.1.78955 WP_000843419.1.78966 WP_000843419.1.7898 WP_000843419.1.79001 WP_000843419.1.79002 WP_000843419.1.7901 WP_000843419.1.79065 WP_000843419.1.79067 WP_000843419.1.79075 WP_000843419.1.79088 WP_000843419.1.79090 WP_000843419.1.79092 WP_000843419.1.79126 WP_000843419.1.79172 WP_000843419.1.79226 WP_000843419.1.79233 WP_000843419.1.79243 WP_000843419.1.79246 WP_000843419.1.79276 WP_000843419.1.79308 WP_000843419.1.79343 WP_000843419.1.79346 WP_000843419.1.79356 WP_000843419.1.79368 WP_000843419.1.79369 WP_000843419.1.7937 WP_000843419.1.79389 WP_000843419.1.79391 WP_000843419.1.7940 WP_000843419.1.79409 WP_000843419.1.79414 WP_000843419.1.79416 WP_000843419.1.79443 WP_000843419.1.79464 WP_000843419.1.79478 WP_000843419.1.79505 WP_000843419.1.79519 WP_000843419.1.7952 WP_000843419.1.79525 WP_000843419.1.79526 WP_000843419.1.79528 WP_000843419.1.79540 WP_000843419.1.79563 WP_000843419.1.79576 WP_000843419.1.79591 WP_000843419.1.79606 WP_000843419.1.79619 WP_000843419.1.79640 WP_000843419.1.79685 WP_000843419.1.79707 WP_000843419.1.79713 WP_000843419.1.79715 WP_000843419.1.79764 WP_000843419.1.79800 WP_000843419.1.79816 WP_000843419.1.79824 WP_000843419.1.7985 WP_000843419.1.79866 WP_000843419.1.79869 WP_000843419.1.79871 WP_000843419.1.79877 WP_000843419.1.79905 WP_000843419.1.79922 WP_000843419.1.7993 WP_000843419.1.79930 WP_000843419.1.79932 WP_000843419.1.79933 WP_000843419.1.79936 WP_000843419.1.79944 WP_000843419.1.79965 WP_000843419.1.79973 WP_000843419.1.79995 WP_000843419.1.80 WP_000843419.1.80011 WP_000843419.1.80016 WP_000843419.1.80026 WP_000843419.1.8004 WP_000843419.1.80043 WP_000843419.1.80050 WP_000843419.1.80060 WP_000843419.1.80061 WP_000843419.1.80063 WP_000843419.1.8007 WP_000843419.1.80071 WP_000843419.1.8011 WP_000843419.1.80112 WP_000843419.1.80141 WP_000843419.1.80176 WP_000843419.1.80179 WP_000843419.1.80183 WP_000843419.1.80192 WP_000843419.1.80309 WP_000843419.1.80310 WP_000843419.1.80330 WP_000843419.1.80388 WP_000843419.1.80392 WP_000843419.1.80402 WP_000843419.1.80426 WP_000843419.1.80444 WP_000843419.1.80456 WP_000843419.1.80463 WP_000843419.1.80484 WP_000843419.1.80519 WP_000843419.1.80524 WP_000843419.1.80545 WP_000843419.1.80577 WP_000843419.1.80578 WP_000843419.1.80594 WP_000843419.1.80606 WP_000843419.1.80666 WP_000843419.1.80676 WP_000843419.1.80709 WP_000843419.1.80718 WP_000843419.1.80731 WP_000843419.1.80736 WP_000843419.1.80737 WP_000843419.1.8074 WP_000843419.1.80753 WP_000843419.1.80754 WP_000843419.1.80756 WP_000843419.1.80768 WP_000843419.1.80789 WP_000843419.1.808 WP_000843419.1.80805 WP_000843419.1.80843 WP_000843419.1.80862 WP_000843419.1.80882 WP_000843419.1.80884 WP_000843419.1.80894 WP_000843419.1.8091 WP_000843419.1.80935 WP_000843419.1.80945 WP_000843419.1.80946 WP_000843419.1.80948 WP_000843419.1.80954 WP_000843419.1.80966 WP_000843419.1.80983 WP_000843419.1.80985 WP_000843419.1.810 WP_000843419.1.81026 WP_000843419.1.81032 WP_000843419.1.81056 WP_000843419.1.81070 WP_000843419.1.81071 WP_000843419.1.81098 WP_000843419.1.811 WP_000843419.1.81104 WP_000843419.1.81120 WP_000843419.1.81127 WP_000843419.1.81141 WP_000843419.1.81160 WP_000843419.1.81165 WP_000843419.1.81180 WP_000843419.1.81182 WP_000843419.1.8121 WP_000843419.1.81219 WP_000843419.1.81266 WP_000843419.1.81267 WP_000843419.1.81273 WP_000843419.1.81281 WP_000843419.1.81283 WP_000843419.1.81286 WP_000843419.1.8129 WP_000843419.1.81298 WP_000843419.1.81316 WP_000843419.1.81323 WP_000843419.1.81376 WP_000843419.1.81391 WP_000843419.1.814 WP_000843419.1.81420 WP_000843419.1.81423 WP_000843419.1.81438 WP_000843419.1.81442 WP_000843419.1.81469 WP_000843419.1.81475 WP_000843419.1.81484 WP_000843419.1.81514 WP_000843419.1.81517 WP_000843419.1.8156 WP_000843419.1.81580 WP_000843419.1.81588 WP_000843419.1.81589 WP_000843419.1.81596 WP_000843419.1.81602 WP_000843419.1.81618 WP_000843419.1.81624 WP_000843419.1.81688 WP_000843419.1.81692 WP_000843419.1.8172 WP_000843419.1.81723 WP_000843419.1.81754 WP_000843419.1.81761 WP_000843419.1.81806 WP_000843419.1.81819 WP_000843419.1.81821 WP_000843419.1.81843 WP_000843419.1.81869 WP_000843419.1.81873 WP_000843419.1.81876 WP_000843419.1.81881 WP_000843419.1.81914 WP_000843419.1.81934 WP_000843419.1.81935 WP_000843419.1.81952 WP_000843419.1.81972 WP_000843419.1.81975 WP_000843419.1.82 WP_000843419.1.82010 WP_000843419.1.82032 WP_000843419.1.82057 WP_000843419.1.82059 WP_000843419.1.82061 WP_000843419.1.82062 WP_000843419.1.82074 WP_000843419.1.82095 WP_000843419.1.82104 WP_000843419.1.82106 WP_000843419.1.82116 WP_000843419.1.82123 WP_000843419.1.82137 WP_000843419.1.82217 WP_000843419.1.82221 WP_000843419.1.82239 WP_000843419.1.82240 WP_000843419.1.82242 WP_000843419.1.82246 WP_000843419.1.82275 WP_000843419.1.82280 WP_000843419.1.82296 WP_000843419.1.82320 WP_000843419.1.82326 WP_000843419.1.82330 WP_000843419.1.82378 WP_000843419.1.82438 WP_000843419.1.82485 WP_000843419.1.82499 WP_000843419.1.82507 WP_000843419.1.82527 WP_000843419.1.82536 WP_000843419.1.82539 WP_000843419.1.8255 WP_000843419.1.82572 WP_000843419.1.82594 WP_000843419.1.82614 WP_000843419.1.82626 WP_000843419.1.82629 WP_000843419.1.82661 WP_000843419.1.8268 WP_000843419.1.82682 WP_000843419.1.82691 WP_000843419.1.82698 WP_000843419.1.82705 WP_000843419.1.82711 WP_000843419.1.82718 WP_000843419.1.82747 WP_000843419.1.8277 WP_000843419.1.82776 WP_000843419.1.82784 WP_000843419.1.82797 WP_000843419.1.82799 WP_000843419.1.82808 WP_000843419.1.82816 WP_000843419.1.82820 WP_000843419.1.82831 WP_000843419.1.82833 WP_000843419.1.82901 WP_000843419.1.82902 WP_000843419.1.82923 WP_000843419.1.82991 WP_000843419.1.83033 WP_000843419.1.83035 WP_000843419.1.83036 WP_000843419.1.83051 WP_000843419.1.8306 WP_000843419.1.83093 WP_000843419.1.83097 WP_000843419.1.83099 WP_000843419.1.83118 WP_000843419.1.83125 WP_000843419.1.83127 WP_000843419.1.83140 WP_000843419.1.83144 WP_000843419.1.83151 WP_000843419.1.83160 WP_000843419.1.83177 WP_000843419.1.83205 WP_000843419.1.83214 WP_000843419.1.83238 WP_000843419.1.83253 WP_000843419.1.83256 WP_000843419.1.83286 WP_000843419.1.83321 WP_000843419.1.83330 WP_000843419.1.83340 WP_000843419.1.83347 WP_000843419.1.83375 WP_000843419.1.83415 WP_000843419.1.83466 WP_000843419.1.83481 WP_000843419.1.83544 WP_000843419.1.83564 WP_000843419.1.83582 WP_000843419.1.83584 WP_000843419.1.83644 WP_000843419.1.83660 WP_000843419.1.83684 WP_000843419.1.83706 WP_000843419.1.83712 WP_000843419.1.83820 WP_000843419.1.8384 WP_000843419.1.8386 WP_000843419.1.83941 WP_000843419.1.83947 WP_000843419.1.84021 WP_000843419.1.8405 WP_000843419.1.84060 WP_000843419.1.84074 WP_000843419.1.8408 WP_000843419.1.84140 WP_000843419.1.84164 WP_000843419.1.84172 WP_000843419.1.84185 WP_000843419.1.84215 WP_000843419.1.84219 WP_000843419.1.84221 WP_000843419.1.84264 WP_000843419.1.84298 WP_000843419.1.84312 WP_000843419.1.84313 WP_000843419.1.84316 WP_000843419.1.84319 WP_000843419.1.84348 WP_000843419.1.84402 WP_000843419.1.84436 WP_000843419.1.84462 WP_000843419.1.84464 WP_000843419.1.84467 WP_000843419.1.8447 WP_000843419.1.84482 WP_000843419.1.84484 WP_000843419.1.84486 WP_000843419.1.84511 WP_000843419.1.84518 WP_000843419.1.84531 WP_000843419.1.84635 WP_000843419.1.84639 WP_000843419.1.84656 WP_000843419.1.84657 WP_000843419.1.84668 WP_000843419.1.84675 WP_000843419.1.8470 WP_000843419.1.84731 WP_000843419.1.84738 WP_000843419.1.84768 WP_000843419.1.8477 WP_000843419.1.84784 WP_000843419.1.84797 WP_000843419.1.84841 WP_000843419.1.84850 WP_000843419.1.84878 WP_000843419.1.84881 WP_000843419.1.84893 WP_000843419.1.84894 WP_000843419.1.84916 WP_000843419.1.84929 WP_000843419.1.84941 WP_000843419.1.84948 WP_000843419.1.84966 WP_000843419.1.84977 WP_000843419.1.84986 WP_000843419.1.85008 WP_000843419.1.85011 WP_000843419.1.85025 WP_000843419.1.85052 WP_000843419.1.85090 WP_000843419.1.85098 WP_000843419.1.85105 WP_000843419.1.85112 WP_000843419.1.85125 WP_000843419.1.85129 WP_000843419.1.85138 WP_000843419.1.85141 WP_000843419.1.85155 WP_000843419.1.85156 WP_000843419.1.85175 WP_000843419.1.85188 WP_000843419.1.85241 WP_000843419.1.85252 WP_000843419.1.85253 WP_000843419.1.85305 WP_000843419.1.85323 WP_000843419.1.85329 WP_000843419.1.85335 WP_000843419.1.85342 WP_000843419.1.85361 WP_000843419.1.85369 WP_000843419.1.85384 WP_000843419.1.85385 WP_000843419.1.85416 WP_000843419.1.85435 WP_000843419.1.85500 WP_000843419.1.85504 WP_000843419.1.85546 WP_000843419.1.85554 WP_000843419.1.85558 WP_000843419.1.85563 WP_000843419.1.85578 WP_000843419.1.85593 WP_000843419.1.8560 WP_000843419.1.85601 WP_000843419.1.85621 WP_000843419.1.85623 WP_000843419.1.85657 WP_000843419.1.85685 WP_000843419.1.85722 WP_000843419.1.85762 WP_000843419.1.85767 WP_000843419.1.85772 WP_000843419.1.85773 WP_000843419.1.85781 WP_000843419.1.8579 WP_000843419.1.85793 WP_000843419.1.85800 WP_000843419.1.85806 WP_000843419.1.85857 WP_000843419.1.85895 WP_000843419.1.85939 WP_000843419.1.85944 WP_000843419.1.85969 WP_000843419.1.86 WP_000843419.1.86001 WP_000843419.1.86016 WP_000843419.1.8603 WP_000843419.1.86035 WP_000843419.1.86063 WP_000843419.1.8607 WP_000843419.1.86104 WP_000843419.1.86105 WP_000843419.1.86110 WP_000843419.1.86115 WP_000843419.1.86145 WP_000843419.1.86149 WP_000843419.1.86161 WP_000843419.1.86166 WP_000843419.1.86171 WP_000843419.1.86179 WP_000843419.1.86181 WP_000843419.1.86189 WP_000843419.1.86196 WP_000843419.1.8621 WP_000843419.1.86210 WP_000843419.1.86225 WP_000843419.1.86227 WP_000843419.1.86228 WP_000843419.1.86234 WP_000843419.1.86261 WP_000843419.1.86263 WP_000843419.1.86266 WP_000843419.1.86273 WP_000843419.1.86276 WP_000843419.1.86280 WP_000843419.1.86283 WP_000843419.1.86307 WP_000843419.1.86340 WP_000843419.1.8635 WP_000843419.1.86355 WP_000843419.1.86364 WP_000843419.1.86371 WP_000843419.1.86376 WP_000843419.1.86393 WP_000843419.1.86411 WP_000843419.1.86451 WP_000843419.1.86454 WP_000843419.1.86483 WP_000843419.1.86492 WP_000843419.1.86518 WP_000843419.1.8652 WP_000843419.1.8656 WP_000843419.1.86560 WP_000843419.1.86574 WP_000843419.1.86583 WP_000843419.1.86598 WP_000843419.1.86613 WP_000843419.1.86617 WP_000843419.1.86640 WP_000843419.1.86667 WP_000843419.1.86673 WP_000843419.1.86674 WP_000843419.1.86681 WP_000843419.1.86707 WP_000843419.1.86717 WP_000843419.1.86727 WP_000843419.1.86734 WP_000843419.1.86753 WP_000843419.1.86760 WP_000843419.1.86768 WP_000843419.1.86788 WP_000843419.1.8679 WP_000843419.1.86833 WP_000843419.1.86846 WP_000843419.1.86848 WP_000843419.1.8687 WP_000843419.1.86935 WP_000843419.1.86956 WP_000843419.1.86975 WP_000843419.1.86994 WP_000843419.1.87043 WP_000843419.1.87059 WP_000843419.1.87067 WP_000843419.1.87075 WP_000843419.1.87076 WP_000843419.1.87102 WP_000843419.1.87109 WP_000843419.1.8711 WP_000843419.1.87177 WP_000843419.1.87189 WP_000843419.1.87199 WP_000843419.1.87247 WP_000843419.1.87249 WP_000843419.1.87254 WP_000843419.1.87310 WP_000843419.1.87339 WP_000843419.1.87358 WP_000843419.1.87371 WP_000843419.1.87382 WP_000843419.1.87400 WP_000843419.1.87410 WP_000843419.1.87465 WP_000843419.1.87557 WP_000843419.1.87563 WP_000843419.1.87568 WP_000843419.1.87574 WP_000843419.1.87581 WP_000843419.1.87607 WP_000843419.1.87608 WP_000843419.1.87610 WP_000843419.1.87616 WP_000843419.1.87633 WP_000843419.1.87635 WP_000843419.1.87639 WP_000843419.1.87675 WP_000843419.1.87694 WP_000843419.1.87696 WP_000843419.1.8771 WP_000843419.1.87726 WP_000843419.1.87728 WP_000843419.1.87766 WP_000843419.1.8778 WP_000843419.1.87786 WP_000843419.1.87788 WP_000843419.1.87789 WP_000843419.1.87834 WP_000843419.1.87883 WP_000843419.1.87973 WP_000843419.1.87976 WP_000843419.1.87980 WP_000843419.1.87984 WP_000843419.1.87989 WP_000843419.1.880 WP_000843419.1.88020 WP_000843419.1.88066 WP_000843419.1.8807 WP_000843419.1.88082 WP_000843419.1.88088 WP_000843419.1.88119 WP_000843419.1.88149 WP_000843419.1.88155 WP_000843419.1.88189 WP_000843419.1.88197 WP_000843419.1.8822 WP_000843419.1.88234 WP_000843419.1.88238 WP_000843419.1.88252 WP_000843419.1.88263 WP_000843419.1.88285 WP_000843419.1.88336 WP_000843419.1.88352 WP_000843419.1.88376 WP_000843419.1.88379 WP_000843419.1.88413 WP_000843419.1.88427 WP_000843419.1.8843 WP_000843419.1.88438 WP_000843419.1.88462 WP_000843419.1.8848 WP_000843419.1.88524 WP_000843419.1.88527 WP_000843419.1.88528 WP_000843419.1.88535 WP_000843419.1.8854 WP_000843419.1.8855 WP_000843419.1.88557 WP_000843419.1.88577 WP_000843419.1.88598 WP_000843419.1.88603 WP_000843419.1.88631 WP_000843419.1.88646 WP_000843419.1.88678 WP_000843419.1.88685 WP_000843419.1.88709 WP_000843419.1.88720 WP_000843419.1.88729 WP_000843419.1.88732 WP_000843419.1.88735 WP_000843419.1.88752 WP_000843419.1.88757 WP_000843419.1.88759 WP_000843419.1.88767 WP_000843419.1.88793 WP_000843419.1.88803 WP_000843419.1.88826 WP_000843419.1.88880 WP_000843419.1.88883 WP_000843419.1.88891 WP_000843419.1.88950 WP_000843419.1.88997 WP_000843419.1.89018 WP_000843419.1.89043 WP_000843419.1.8906 WP_000843419.1.89067 WP_000843419.1.89069 WP_000843419.1.89111 WP_000843419.1.89165 WP_000843419.1.89197 WP_000843419.1.89200 WP_000843419.1.89203 WP_000843419.1.89214 WP_000843419.1.89255 WP_000843419.1.89285 WP_000843419.1.89305 WP_000843419.1.89322 WP_000843419.1.89334 WP_000843419.1.89335 WP_000843419.1.8938 WP_000843419.1.89385 WP_000843419.1.89396 WP_000843419.1.894 WP_000843419.1.89400 WP_000843419.1.89403 WP_000843419.1.89405 WP_000843419.1.89432 WP_000843419.1.8945 WP_000843419.1.89455 WP_000843419.1.89466 WP_000843419.1.89469 WP_000843419.1.89492 WP_000843419.1.89510 WP_000843419.1.89551 WP_000843419.1.89569 WP_000843419.1.89583 WP_000843419.1.89601 WP_000843419.1.89605 WP_000843419.1.89627 WP_000843419.1.89630 WP_000843419.1.89631 WP_000843419.1.89646 WP_000843419.1.89656 WP_000843419.1.89700 WP_000843419.1.89710 WP_000843419.1.89768 WP_000843419.1.89781 WP_000843419.1.89788 WP_000843419.1.89818 WP_000843419.1.89839 WP_000843419.1.89841 WP_000843419.1.8985 WP_000843419.1.89852 WP_000843419.1.89859 WP_000843419.1.89879 WP_000843419.1.89895 WP_000843419.1.89899 WP_000843419.1.89915 WP_000843419.1.89918 WP_000843419.1.89920 WP_000843419.1.89923 WP_000843419.1.89925 WP_000843419.1.89927 WP_000843419.1.89959 WP_000843419.1.89988 WP_000843419.1.89998 WP_000843419.1.90050 WP_000843419.1.90063 WP_000843419.1.90065 WP_000843419.1.9009 WP_000843419.1.9010 WP_000843419.1.90115 WP_000843419.1.90139 WP_000843419.1.90146 WP_000843419.1.90156 WP_000843419.1.90171 WP_000843419.1.90182 WP_000843419.1.902 WP_000843419.1.90205 WP_000843419.1.90219 WP_000843419.1.90249 WP_000843419.1.90257 WP_000843419.1.90266 WP_000843419.1.90270 WP_000843419.1.90314 WP_000843419.1.90332 WP_000843419.1.90342 WP_000843419.1.90349 WP_000843419.1.90357 WP_000843419.1.90389 WP_000843419.1.90405 WP_000843419.1.90435 WP_000843419.1.90436 WP_000843419.1.90441 WP_000843419.1.90449 WP_000843419.1.90467 WP_000843419.1.90525 WP_000843419.1.90542 WP_000843419.1.90547 WP_000843419.1.9059 WP_000843419.1.90591 WP_000843419.1.9061 WP_000843419.1.90626 WP_000843419.1.90690 WP_000843419.1.90703 WP_000843419.1.90706 WP_000843419.1.90758 WP_000843419.1.90775 WP_000843419.1.9081 WP_000843419.1.90813 WP_000843419.1.90822 WP_000843419.1.90834 WP_000843419.1.90837 WP_000843419.1.90839 WP_000843419.1.9084 WP_000843419.1.90844 WP_000843419.1.90848 WP_000843419.1.90864 WP_000843419.1.90865 WP_000843419.1.9087 WP_000843419.1.90873 WP_000843419.1.90890 WP_000843419.1.909 WP_000843419.1.90905 WP_000843419.1.90924 WP_000843419.1.90967 WP_000843419.1.9098 WP_000843419.1.90988 WP_000843419.1.90996 WP_000843419.1.90997 WP_000843419.1.91 WP_000843419.1.91007 WP_000843419.1.91018 WP_000843419.1.91072 WP_000843419.1.91088 WP_000843419.1.91094 WP_000843419.1.91113 WP_000843419.1.91117 WP_000843419.1.91121 WP_000843419.1.91138 WP_000843419.1.91143 WP_000843419.1.91153 WP_000843419.1.9118 WP_000843419.1.91266 WP_000843419.1.91268 WP_000843419.1.91290 WP_000843419.1.91354 WP_000843419.1.91356 WP_000843419.1.91361 WP_000843419.1.91384 WP_000843419.1.91397 WP_000843419.1.91425 WP_000843419.1.91485 WP_000843419.1.91511 WP_000843419.1.91516 WP_000843419.1.91526 WP_000843419.1.91543 WP_000843419.1.91548 WP_000843419.1.91549 WP_000843419.1.91565 WP_000843419.1.91566 WP_000843419.1.9157 WP_000843419.1.91594 WP_000843419.1.91596 WP_000843419.1.91626 WP_000843419.1.91630 WP_000843419.1.91640 WP_000843419.1.91643 WP_000843419.1.91644 WP_000843419.1.91651 WP_000843419.1.9168 WP_000843419.1.91685 WP_000843419.1.91701 WP_000843419.1.9171 WP_000843419.1.91756 WP_000843419.1.91777 WP_000843419.1.91779 WP_000843419.1.91782 WP_000843419.1.91787 WP_000843419.1.91793 WP_000843419.1.91801 WP_000843419.1.91843 WP_000843419.1.9185 WP_000843419.1.91871 WP_000843419.1.91893 WP_000843419.1.91951 WP_000843419.1.91954 WP_000843419.1.91959 WP_000843419.1.91965 WP_000843419.1.91971 WP_000843419.1.9199 WP_000843419.1.91994 WP_000843419.1.92005 WP_000843419.1.92014 WP_000843419.1.92019 WP_000843419.1.92025 WP_000843419.1.92029 WP_000843419.1.92031 WP_000843419.1.92048 WP_000843419.1.92058 WP_000843419.1.9209 WP_000843419.1.92096 WP_000843419.1.921 WP_000843419.1.92102 WP_000843419.1.92123 WP_000843419.1.92180 WP_000843419.1.92195 WP_000843419.1.92215 WP_000843419.1.92224 WP_000843419.1.92304 WP_000843419.1.92305 WP_000843419.1.92311 WP_000843419.1.92384 WP_000843419.1.924 WP_000843419.1.92434 WP_000843419.1.92462 WP_000843419.1.92495 WP_000843419.1.92506 WP_000843419.1.92532 WP_000843419.1.92535 WP_000843419.1.9255 WP_000843419.1.92571 WP_000843419.1.92577 WP_000843419.1.92638 WP_000843419.1.9264 WP_000843419.1.9266 WP_000843419.1.92668 WP_000843419.1.92693 WP_000843419.1.92708 WP_000843419.1.92719 WP_000843419.1.92750 WP_000843419.1.92767 WP_000843419.1.92780 WP_000843419.1.92781 WP_000843419.1.92793 WP_000843419.1.92796 WP_000843419.1.92819 WP_000843419.1.92865 WP_000843419.1.92882 WP_000843419.1.92886 WP_000843419.1.92932 WP_000843419.1.92953 WP_000843419.1.92991 WP_000843419.1.93005 WP_000843419.1.93016 WP_000843419.1.93017 WP_000843419.1.93023 WP_000843419.1.93027 WP_000843419.1.93033 WP_000843419.1.93052 WP_000843419.1.93069 WP_000843419.1.93072 WP_000843419.1.93100 WP_000843419.1.93112 WP_000843419.1.93133 WP_000843419.1.93138 WP_000843419.1.93139 WP_000843419.1.93150 WP_000843419.1.93167 WP_000843419.1.93185 WP_000843419.1.93252 WP_000843419.1.93267 WP_000843419.1.9327 WP_000843419.1.93291 WP_000843419.1.93309 WP_000843419.1.9331 WP_000843419.1.93326 WP_000843419.1.93338 WP_000843419.1.93379 WP_000843419.1.93388 WP_000843419.1.93427 WP_000843419.1.93428 WP_000843419.1.93461 WP_000843419.1.93463 WP_000843419.1.93464 WP_000843419.1.93468 WP_000843419.1.93509 WP_000843419.1.93552 WP_000843419.1.9356 WP_000843419.1.93601 WP_000843419.1.93605 WP_000843419.1.93630 WP_000843419.1.93634 WP_000843419.1.93637 WP_000843419.1.93670 WP_000843419.1.93679 WP_000843419.1.93695 WP_000843419.1.93733 WP_000843419.1.93737 WP_000843419.1.93742 WP_000843419.1.93743 WP_000843419.1.93745 WP_000843419.1.93765 WP_000843419.1.938 WP_000843419.1.93800 WP_000843419.1.93821 WP_000843419.1.93870 WP_000843419.1.93873 WP_000843419.1.93877 WP_000843419.1.939 WP_000843419.1.93900 WP_000843419.1.93918 WP_000843419.1.93921 WP_000843419.1.93922 WP_000843419.1.93951 WP_000843419.1.94008 WP_000843419.1.94011 WP_000843419.1.94025 WP_000843419.1.94028 WP_000843419.1.94035 WP_000843419.1.94040 WP_000843419.1.94069 WP_000843419.1.94156 WP_000843419.1.9416 WP_000843419.1.94213 WP_000843419.1.94232 WP_000843419.1.9426 WP_000843419.1.94302 WP_000843419.1.94317 WP_000843419.1.94343 WP_000843419.1.94353 WP_000843419.1.94404 WP_000843419.1.94417 WP_000843419.1.94429 WP_000843419.1.94438 WP_000843419.1.94445 WP_000843419.1.94468 WP_000843419.1.94497 WP_000843419.1.94507 WP_000843419.1.94516 WP_000843419.1.94523 WP_000843419.1.94542 WP_000843419.1.94544 WP_000843419.1.94548 WP_000843419.1.94578 WP_000843419.1.94580 WP_000843419.1.94589 WP_000843419.1.94646 WP_000843419.1.94676 WP_000843419.1.94690 WP_000843419.1.94692 WP_000843419.1.94695 WP_000843419.1.94739 WP_000843419.1.9474 WP_000843419.1.94753 WP_000843419.1.94764 WP_000843419.1.94787 WP_000843419.1.94790 WP_000843419.1.94801 WP_000843419.1.94808 WP_000843419.1.94822 WP_000843419.1.94823 WP_000843419.1.94836 WP_000843419.1.94841 WP_000843419.1.94869 WP_000843419.1.94877 WP_000843419.1.94880 WP_000843419.1.94889 WP_000843419.1.94892 WP_000843419.1.94898 WP_000843419.1.949 WP_000843419.1.94903 WP_000843419.1.9491 WP_000843419.1.94927 WP_000843419.1.94934 WP_000843419.1.94935 WP_000843419.1.94955 WP_000843419.1.94963 WP_000843419.1.94991 WP_000843419.1.94997 WP_000843419.1.95005 WP_000843419.1.95011 WP_000843419.1.95022 WP_000843419.1.95028 WP_000843419.1.95035 WP_000843419.1.95036 WP_000843419.1.95062 WP_000843419.1.95084 WP_000843419.1.95105 WP_000843419.1.95129 WP_000843419.1.9513 WP_000843419.1.95161 WP_000843419.1.95198 WP_000843419.1.95233 WP_000843419.1.95243 WP_000843419.1.95244 WP_000843419.1.95254 WP_000843419.1.95275 WP_000843419.1.95329 WP_000843419.1.95364 WP_000843419.1.95366 WP_000843419.1.95368 WP_000843419.1.95378 WP_000843419.1.95381 WP_000843419.1.95390 WP_000843419.1.95398 WP_000843419.1.95400 WP_000843419.1.95403 WP_000843419.1.95424 WP_000843419.1.95428 WP_000843419.1.95431 WP_000843419.1.95438 WP_000843419.1.95449 WP_000843419.1.95490 WP_000843419.1.95518 WP_000843419.1.95521 WP_000843419.1.95563 WP_000843419.1.9559 WP_000843419.1.95596 WP_000843419.1.95604 WP_000843419.1.95611 WP_000843419.1.95628 WP_000843419.1.95634 WP_000843419.1.95655 WP_000843419.1.9566 WP_000843419.1.95666 WP_000843419.1.95712 WP_000843419.1.95756 WP_000843419.1.95759 WP_000843419.1.95771 WP_000843419.1.95783 WP_000843419.1.95800 WP_000843419.1.95801 WP_000843419.1.95821 WP_000843419.1.95824 WP_000843419.1.95834 WP_000843419.1.95835 WP_000843419.1.95865 WP_000843419.1.95869 WP_000843419.1.95916 WP_000843419.1.95929 WP_000843419.1.95931 WP_000843419.1.960 WP_000843419.1.96015 WP_000843419.1.96032 WP_000843419.1.96053 WP_000843419.1.96059 WP_000843419.1.96066 WP_000843419.1.96086 WP_000843419.1.96097 WP_000843419.1.96114 WP_000843419.1.96128 WP_000843419.1.96143 WP_000843419.1.96145 WP_000843419.1.9616 WP_000843419.1.96177 WP_000843419.1.96222 WP_000843419.1.96223 WP_000843419.1.96229 WP_000843419.1.96247 WP_000843419.1.96278 WP_000843419.1.96281 WP_000843419.1.96290 WP_000843419.1.96293 WP_000843419.1.9631 WP_000843419.1.96341 WP_000843419.1.96392 WP_000843419.1.9641 WP_000843419.1.96420 WP_000843419.1.96425 WP_000843419.1.96450 WP_000843419.1.96457 WP_000843419.1.96480 WP_000843419.1.96484 WP_000843419.1.96494 WP_000843419.1.965 WP_000843419.1.96519 WP_000843419.1.96541 WP_000843419.1.96558 WP_000843419.1.96562 WP_000843419.1.9657 WP_000843419.1.96585 WP_000843419.1.96608 WP_000843419.1.9661 WP_000843419.1.96659 WP_000843419.1.9668 WP_000843419.1.96680 WP_000843419.1.96683 WP_000843419.1.96695 WP_000843419.1.96701 WP_000843419.1.9671 WP_000843419.1.96725 WP_000843419.1.96743 WP_000843419.1.96753 WP_000843419.1.96759 WP_000843419.1.96762 WP_000843419.1.96769 WP_000843419.1.96779 WP_000843419.1.96796 WP_000843419.1.96817 WP_000843419.1.9682 WP_000843419.1.96820 WP_000843419.1.96850 WP_000843419.1.96864 WP_000843419.1.9690 WP_000843419.1.96907 WP_000843419.1.9691 WP_000843419.1.96932 WP_000843419.1.96936 WP_000843419.1.96944 WP_000843419.1.96984 WP_000843419.1.96989 WP_000843419.1.97027 WP_000843419.1.97049 WP_000843419.1.97059 WP_000843419.1.9708 WP_000843419.1.97147 WP_000843419.1.97170 WP_000843419.1.97193 WP_000843419.1.97195 WP_000843419.1.97200 WP_000843419.1.97226 WP_000843419.1.97248 WP_000843419.1.97279 WP_000843419.1.97292 WP_000843419.1.97344 WP_000843419.1.97351 WP_000843419.1.97356 WP_000843419.1.97360 WP_000843419.1.97361 WP_000843419.1.97379 WP_000843419.1.97387 WP_000843419.1.9740 WP_000843419.1.97402 WP_000843419.1.97421 WP_000843419.1.97434 WP_000843419.1.97459 WP_000843419.1.9747 WP_000843419.1.97490 WP_000843419.1.97502 WP_000843419.1.97513 WP_000843419.1.97527 WP_000843419.1.97538 WP_000843419.1.97544 WP_000843419.1.97560 WP_000843419.1.97571 WP_000843419.1.97632 WP_000843419.1.97667 WP_000843419.1.97675 WP_000843419.1.97677 WP_000843419.1.97685 WP_000843419.1.9770 WP_000843419.1.97705 WP_000843419.1.97711 WP_000843419.1.97770 WP_000843419.1.97775 WP_000843419.1.97789 WP_000843419.1.97798 WP_000843419.1.978 WP_000843419.1.97802 WP_000843419.1.97815 WP_000843419.1.97822 WP_000843419.1.97823 WP_000843419.1.97871 WP_000843419.1.97890 WP_000843419.1.97895 WP_000843419.1.97919 WP_000843419.1.97932 WP_000843419.1.97937 WP_000843419.1.97962 WP_000843419.1.97982 WP_000843419.1.97996 WP_000843419.1.98000 WP_000843419.1.98005 WP_000843419.1.98012 WP_000843419.1.98026 WP_000843419.1.9803 WP_000843419.1.98046 WP_000843419.1.98082 WP_000843419.1.98083 WP_000843419.1.981 WP_000843419.1.98102 WP_000843419.1.98115 WP_000843419.1.98139 WP_000843419.1.98155 WP_000843419.1.9816 WP_000843419.1.98167 WP_000843419.1.9817 WP_000843419.1.98176 WP_000843419.1.98187 WP_000843419.1.98202 WP_000843419.1.98205 WP_000843419.1.98208 WP_000843419.1.98232 WP_000843419.1.98239 WP_000843419.1.98244 WP_000843419.1.98251 WP_000843419.1.98284 WP_000843419.1.98292 WP_000843419.1.98301 WP_000843419.1.98312 WP_000843419.1.98323 WP_000843419.1.98357 WP_000843419.1.98384 WP_000843419.1.98400 WP_000843419.1.98404 WP_000843419.1.98429 WP_000843419.1.9844 WP_000843419.1.98442 WP_000843419.1.98451 WP_000843419.1.98477 WP_000843419.1.98480 WP_000843419.1.98498 WP_000843419.1.98543 WP_000843419.1.98549 WP_000843419.1.98569 WP_000843419.1.98578 WP_000843419.1.9858 WP_000843419.1.98587 WP_000843419.1.98603 WP_000843419.1.98614 WP_000843419.1.98633 WP_000843419.1.9864 WP_000843419.1.98641 WP_000843419.1.98654 WP_000843419.1.98665 WP_000843419.1.98668 WP_000843419.1.98683 WP_000843419.1.98702 WP_000843419.1.98757 WP_000843419.1.98795 WP_000843419.1.9883 WP_000843419.1.98875 WP_000843419.1.98886 WP_000843419.1.98908 WP_000843419.1.98920 WP_000843419.1.98976 WP_000843419.1.98988 WP_000843419.1.99029 WP_000843419.1.99046 WP_000843419.1.99053 WP_000843419.1.9907 WP_000843419.1.99101 WP_000843419.1.99110 WP_000843419.1.99119 WP_000843419.1.99168 WP_000843419.1.99182 WP_000843419.1.99209 WP_000843419.1.99234 WP_000843419.1.99246 WP_000843419.1.99265 WP_000843419.1.99289 WP_000843419.1.99292 WP_000843419.1.99295 WP_000843419.1.99302 WP_000843419.1.99304 WP_000843419.1.99307 WP_000843419.1.99310 WP_000843419.1.99334 WP_000843419.1.99345 WP_000843419.1.9935 WP_000843419.1.99361 WP_000843419.1.99366 WP_000843419.1.9940 WP_000843419.1.99400 WP_000843419.1.99427 WP_000843419.1.99446 WP_000843419.1.99458 WP_000843419.1.99471 WP_000843419.1.99475 WP_000843419.1.99486 WP_000843419.1.99487 WP_000843419.1.99498 WP_000843419.1.99501 WP_000843419.1.99511 WP_000843419.1.99534 WP_000843419.1.99562 WP_000843419.1.99571 WP_000843419.1.99592 WP_000843419.1.99619 WP_000843419.1.99632 WP_000843419.1.99641 WP_000843419.1.99666 WP_000843419.1.99692 WP_000843419.1.99694 WP_000843419.1.99771 WP_000843419.1.99774 WP_000843419.1.99791 WP_000843419.1.99804 WP_000843419.1.99827 WP_000843419.1.99869 WP_000843419.1.99874 WP_000843419.1.99892 WP_000843419.1.99912 WP_000843419.1.99929 WP_000843419.1.99986 YP_002407806.1.10275 YP_002412533.1.14968 YP_006779255.1.12065 YP_403216.2.10455 gi|386634168|ref|YP_006153887.1| gi|26247807|ref|NP_753847.1| gi|386709352|ref|YP_006173073.1| gi|386639039|ref|YP_006105837.1| gi|386624111|ref|YP_006143839.1| gi|187730965|ref|YP_001880258.1| gi|157161002|ref|YP_001458320.1| gi|161950114|ref|YP_403216.2| gi|157158832|ref|YP_001462815.1| gi|218705014|ref|YP_002412533.1| gi|387506744|ref|YP_006159000.1| gi|161986526|ref|YP_310531.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]