SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384543293|ref|YP_005727355.1| from Shigella flexneri 2002017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384543293|ref|YP_005727355.1|
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.14e-35
Family MarR-like transcriptional regulators 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384543293|ref|YP_005727355.1|
Sequence length 146
Comment MarR family transcriptional regulator [Shigella flexneri 2002017]
Sequence
MKLESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGI
EQPSLVRTLDQLEEKGLISRQTCASDRRAKRIKLTEKAEPLISEMEAVINKTRAEILHGI
SAEELEQLITLIAKLEHNIIELQAKG
Download sequence
Identical sequences A0A090NB17 A0A0A0FEM2 A0A0A6ZTJ9 A0A0F6ME04 A0A1X3IYR6 A0A1X3JFW8 A0A1X3L395 B3X4L7 B6IB81 C3T8P2 D2AGE3 D6HXC7 D6IAV4 D7XNE7 D7Y2M4 D8ABD8 D8E4C7 E1IKD5 E1J4C5 E6BE14 E9TLU7 F4NFM9 F4SJQ1 F4TGJ0 F4VFM8 I0VMB2 J7RTH7 Q0T4D3 Q320Z9 Q32FD1 Q3Z1Z8 U9XX16 U9YTZ8 U9ZW59
gi|384543293|ref|YP_005727355.1| NP_707544.3.23235 APC27638 IDP00098 gi|544390296|ref|YP_008564820.1| gi|560157224|ref|YP_008849939.1| 373384.SFV_1661 409438.ECSE_1765 481805.EcolC_1987 gi|209918956|ref|YP_002293040.1| gi|344915275|ref|NP_707544.3| gi|110805617|ref|YP_689137.1| gi|170020006|ref|YP_001724960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]