SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384544148|ref|YP_005728211.1| from Shigella flexneri 2002017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384544148|ref|YP_005728211.1|
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.18e-36
Family Transcriptional regulator Rrf2 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384544148|ref|YP_005728211.1|
Sequence length 162
Comment HTH-type transcriptional regulator iscR [Shigella flexneri 2002017]
Sequence
MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRG
PGGGYLLGKDASSIAVGEVISAVDESVDATRCQGKGGCQGGDKCLTHALWRDLSDRLTGF
LNNITLGELVNNQEVLDVSGRQHTHDAPRTRTQDAIDVKLRA
Download sequence
Identical sequences A0A023Z1C6 A0A024KXQ6 A0A025CD74 A0A026UK09 A0A029HPN5 A0A029IMZ5 A0A062Y6D6 A0A064TBU7 A0A069XM04 A0A070SQM0 A0A070UZY4 A0A073HAU0 A0A073UNR0 A0A080IRI1 A0A090NGA5 A0A0A0FAZ3 A0A0E0U1P8 A0A0E0V820 A0A0E0XX77 A0A0E1M0C0 A0A0E1SWD7 A0A0E2L340 A0A0E2TUK1 A0A0F6C7L5 A0A0F6FAP8 A0A0F6MFK7 A0A0G3K6W1 A0A0H3EJU2 A0A0H3PW81 A0A0M7NPM5 A0A125X0Q4 A0A127GNA6 A0A140N8Z3 A0A142H5F4 A0A181WPT3 A0A192CAX7 A0A1E2VSN1 A0A1E3MYC6 A0A1H0LAI0 A0A1Q8MIQ0 A0A1Q8MX00 A0A1W2MRJ6 A0A1X3I429 A0A1X3IK80 A0A1X3J2B8 A0A1X3JF30 A0A1X3K9C3 A0A1X3L0R7 A0A1X3LGB8 A0A1X3M0P1 A0A1X3MAR1 A0A1Z3V0V8 A0A222QNJ1 A0A226KCH8 A0A2D0NTQ8 A0A2I8CB53 A1AE68 A7ZPX5 B1LNI7 B1XB06 B2TXV6 B3WYF7 B5Z105 B7LDC3 B7LJQ3 B7MIM1 B7MYG4 B7N6B8 B7NRI0 B7UGX7 C3SZN7 C4ZXA6 C8U850 D2AGX6 D3H3P1 D3QN22 D6HWQ7 D6I9W7 D6JD05 D7X7C4 D7XMW7 D7Y9P1 D7ZIF6 D8AEG8 E0J4M9 E1J3L1 E2X5S9 E3PG75 E3XJU8 E6BGV6 E7SY22 E7TA29 E9XJV0 E9YR51 F0JTS7 F3V8G7 F3WKS2 F4SHX7 F4T212 F4THL0 F5N5M8 F5NY36 G0FG01 H4IEB0 H4IVB4 H4JB89 H4KK58 H4LFB0 H4UMH1 I2RJI1 I2S1G2 I2SY48 I2WVH2 I2XED7 I4T774 I6BHK0 I6D7V4 I6DW88 I6FNE9 I6GYY7 J7QP63 K0X1I7 L2UZ41 L2VSH1 L2XHH7 L3C6D5 L3Q481 L3QFD4 L4J2P1 L4V7B4 M9H2N9 P0AGK8 P0AGK9 P0AGL0 P0AGL1 Q0T1Y8 Q0TEV4 Q1R8K1 Q31XV9 Q32D33 S0VPP3 S0XHH5 S0Z3Q4 S1C4W6 S1CTG6 S1G9H3 S1GS35 S1I2B2 S1LPS3 S1PX21 T5UP69 T6A5U0 T6H8J7 T6LU39 T9DLU6 T9TLK5 U9XZR0 U9YLY3 U9YRX4 U9ZQ11 V0SRN1 V0W9Y2 V0XJP1 V0Y8T6 V2SR26 V2TGV0 V8KG68 W1B3Y7 W1X7P9 W8ZL94
gi|443618586|ref|YP_007382442.1| gi|387617847|ref|YP_006120869.1| gi|82544980|ref|YP_408927.1| gi|386635224|ref|YP_006154943.1| gi|387622231|ref|YP_006129859.1| gi|117624759|ref|YP_853672.1| gi|110642696|ref|YP_670426.1| gi|378712008|ref|YP_005276901.1| gi|15832651|ref|NP_311424.1| gi|15803058|ref|NP_289088.1| gi|170684046|ref|YP_001744720.1| gi|26248899|ref|NP_754939.1| gi|386615237|ref|YP_006134903.1| gi|238901696|ref|YP_002927492.1| gi|407470427|ref|YP_006783130.1| gi|388478567|ref|YP_490759.1| gi|386625269|ref|YP_006144997.1| gi|387613127|ref|YP_006116243.1| gi|254794481|ref|YP_003079318.1| gi|387622231|ref|YP_006129859.1| gi|387830428|ref|YP_003350365.1| gi|386603430|ref|YP_006109730.1| gi|209399149|ref|YP_002272006.1| gi|291283756|ref|YP_003500574.1| 155864.Z3798 198214.SF2578 198215.S2750 199310.c3057 300267.SDY_2727 300268.SBO_2555 316385.ECDH10B_2698 316407.iscR 331111.EcE24377A_2816 344609.SbBS512_E2906 362663.ECP_2536 364106.UTI89_C2853 373384.SFV_2579 386585.ECs3397 405955.APECO1_3994 413997.ECB_02423 439855.EcSMS35_2684 444450.ECH74115_3763 469008.ECBD_1153 511145.b2531 544404.ECSP_3475 574521.E2348C_2814 585035.ECS88_2707 585054.EFER_0641 585055.EC55989_2816 585056.ECUMN_2851 585057.ECIAI39_2732 585395.ECO103_3048 585397.ECED1_2962 595496.BWG_2295 gi|110806462|ref|YP_689982.1| gi|222157237|ref|YP_002557376.1| gi|251785858|ref|YP_003000162.1| gi|386630304|ref|YP_006150024.1| gi|544577006|ref|YP_008572530.1| gi|544391095|ref|YP_008565675.1| gi|556552471|ref|YP_008722783.1| gi|218559457|ref|YP_002392370.1| gi|218690651|ref|YP_002398863.1| gi|218548032|ref|YP_002381823.1| gi|82777914|ref|YP_404263.1| gi|260845161|ref|YP_003222939.1| gi|215487881|ref|YP_002330312.1| gi|560158392|ref|YP_008851107.1| gi|170082141|ref|YP_001731461.1| gi|218696158|ref|YP_002403825.1| NP_311424.1.58667 NP_417026.1.90541 NP_708370.1.23235 WP_001241357.1.1000 WP_001241357.1.10001 WP_001241357.1.100014 WP_001241357.1.100044 WP_001241357.1.100052 WP_001241357.1.100073 WP_001241357.1.100085 WP_001241357.1.10010 WP_001241357.1.100111 WP_001241357.1.100116 WP_001241357.1.100138 WP_001241357.1.100151 WP_001241357.1.100185 WP_001241357.1.100194 WP_001241357.1.100220 WP_001241357.1.100227 WP_001241357.1.100251 WP_001241357.1.100252 WP_001241357.1.100281 WP_001241357.1.100283 WP_001241357.1.100285 WP_001241357.1.100299 WP_001241357.1.100302 WP_001241357.1.100304 WP_001241357.1.100306 WP_001241357.1.10034 WP_001241357.1.100441 WP_001241357.1.100447 WP_001241357.1.100451 WP_001241357.1.100474 WP_001241357.1.100487 WP_001241357.1.100496 WP_001241357.1.100499 WP_001241357.1.100508 WP_001241357.1.10051 WP_001241357.1.100531 WP_001241357.1.100554 WP_001241357.1.100571 WP_001241357.1.100614 WP_001241357.1.100685 WP_001241357.1.100688 WP_001241357.1.100735 WP_001241357.1.100738 WP_001241357.1.100778 WP_001241357.1.10080 WP_001241357.1.100803 WP_001241357.1.100824 WP_001241357.1.10086 WP_001241357.1.100868 WP_001241357.1.100898 WP_001241357.1.100916 WP_001241357.1.100925 WP_001241357.1.100933 WP_001241357.1.100950 WP_001241357.1.100959 WP_001241357.1.100966 WP_001241357.1.100990 WP_001241357.1.10100 WP_001241357.1.101033 WP_001241357.1.101052 WP_001241357.1.101087 WP_001241357.1.101096 WP_001241357.1.1011 WP_001241357.1.101105 WP_001241357.1.101110 WP_001241357.1.101148 WP_001241357.1.101152 WP_001241357.1.101158 WP_001241357.1.101166 WP_001241357.1.101186 WP_001241357.1.101206 WP_001241357.1.101257 WP_001241357.1.101282 WP_001241357.1.101289 WP_001241357.1.10131 WP_001241357.1.101359 WP_001241357.1.10138 WP_001241357.1.101387 WP_001241357.1.101399 WP_001241357.1.101423 WP_001241357.1.101429 WP_001241357.1.101430 WP_001241357.1.101439 WP_001241357.1.101445 WP_001241357.1.101518 WP_001241357.1.101522 WP_001241357.1.101545 WP_001241357.1.101586 WP_001241357.1.101628 WP_001241357.1.101651 WP_001241357.1.101654 WP_001241357.1.101667 WP_001241357.1.101693 WP_001241357.1.101694 WP_001241357.1.101700 WP_001241357.1.101727 WP_001241357.1.10173 WP_001241357.1.101737 WP_001241357.1.101747 WP_001241357.1.101769 WP_001241357.1.101777 WP_001241357.1.10181 WP_001241357.1.101822 WP_001241357.1.101845 WP_001241357.1.101855 WP_001241357.1.101865 WP_001241357.1.10188 WP_001241357.1.101900 WP_001241357.1.101926 WP_001241357.1.101932 WP_001241357.1.101935 WP_001241357.1.101948 WP_001241357.1.101962 WP_001241357.1.101964 WP_001241357.1.101969 WP_001241357.1.101977 WP_001241357.1.101984 WP_001241357.1.101987 WP_001241357.1.102036 WP_001241357.1.10206 WP_001241357.1.102076 WP_001241357.1.102094 WP_001241357.1.102104 WP_001241357.1.102106 WP_001241357.1.102139 WP_001241357.1.102144 WP_001241357.1.10226 WP_001241357.1.10235 WP_001241357.1.10252 WP_001241357.1.10273 WP_001241357.1.10304 WP_001241357.1.10326 WP_001241357.1.10335 WP_001241357.1.10361 WP_001241357.1.10379 WP_001241357.1.10381 WP_001241357.1.1040 WP_001241357.1.10400 WP_001241357.1.10417 WP_001241357.1.10476 WP_001241357.1.10491 WP_001241357.1.10492 WP_001241357.1.10496 WP_001241357.1.10524 WP_001241357.1.10569 WP_001241357.1.10573 WP_001241357.1.10605 WP_001241357.1.10697 WP_001241357.1.10705 WP_001241357.1.1071 WP_001241357.1.10729 WP_001241357.1.1073 WP_001241357.1.1074 WP_001241357.1.10744 WP_001241357.1.10748 WP_001241357.1.10761 WP_001241357.1.10786 WP_001241357.1.10787 WP_001241357.1.10809 WP_001241357.1.10814 WP_001241357.1.10824 WP_001241357.1.10833 WP_001241357.1.10842 WP_001241357.1.10849 WP_001241357.1.10869 WP_001241357.1.10970 WP_001241357.1.10988 WP_001241357.1.10989 WP_001241357.1.10994 WP_001241357.1.11006 WP_001241357.1.11032 WP_001241357.1.11047 WP_001241357.1.11052 WP_001241357.1.11057 WP_001241357.1.11068 WP_001241357.1.1111 WP_001241357.1.11113 WP_001241357.1.1113 WP_001241357.1.11133 WP_001241357.1.11217 WP_001241357.1.11240 WP_001241357.1.11241 WP_001241357.1.11250 WP_001241357.1.11265 WP_001241357.1.11285 WP_001241357.1.11296 WP_001241357.1.11301 WP_001241357.1.11315 WP_001241357.1.11399 WP_001241357.1.11408 WP_001241357.1.11411 WP_001241357.1.11420 WP_001241357.1.11436 WP_001241357.1.11437 WP_001241357.1.11467 WP_001241357.1.11519 WP_001241357.1.11531 WP_001241357.1.11542 WP_001241357.1.11575 WP_001241357.1.11578 WP_001241357.1.11607 WP_001241357.1.11608 WP_001241357.1.11612 WP_001241357.1.11671 WP_001241357.1.11690 WP_001241357.1.11699 WP_001241357.1.11748 WP_001241357.1.11803 WP_001241357.1.11844 WP_001241357.1.1186 WP_001241357.1.11912 WP_001241357.1.11948 WP_001241357.1.11955 WP_001241357.1.11956 WP_001241357.1.1196 WP_001241357.1.11981 WP_001241357.1.11982 WP_001241357.1.12009 WP_001241357.1.12010 WP_001241357.1.12036 WP_001241357.1.12050 WP_001241357.1.12051 WP_001241357.1.12060 WP_001241357.1.12076 WP_001241357.1.12088 WP_001241357.1.12111 WP_001241357.1.12115 WP_001241357.1.1212 WP_001241357.1.12151 WP_001241357.1.12157 WP_001241357.1.12174 WP_001241357.1.12230 WP_001241357.1.12259 WP_001241357.1.12268 WP_001241357.1.12279 WP_001241357.1.12295 WP_001241357.1.12305 WP_001241357.1.12319 WP_001241357.1.12320 WP_001241357.1.12342 WP_001241357.1.12344 WP_001241357.1.12352 WP_001241357.1.12415 WP_001241357.1.1242 WP_001241357.1.12459 WP_001241357.1.12468 WP_001241357.1.12478 WP_001241357.1.12542 WP_001241357.1.12552 WP_001241357.1.12558 WP_001241357.1.12574 WP_001241357.1.12582 WP_001241357.1.12594 WP_001241357.1.12646 WP_001241357.1.12675 WP_001241357.1.12679 WP_001241357.1.12680 WP_001241357.1.12697 WP_001241357.1.127 WP_001241357.1.12709 WP_001241357.1.1275 WP_001241357.1.12756 WP_001241357.1.12761 WP_001241357.1.12762 WP_001241357.1.12763 WP_001241357.1.12766 WP_001241357.1.12775 WP_001241357.1.1278 WP_001241357.1.12781 WP_001241357.1.12826 WP_001241357.1.12830 WP_001241357.1.12893 WP_001241357.1.12911 WP_001241357.1.12914 WP_001241357.1.12915 WP_001241357.1.12917 WP_001241357.1.12944 WP_001241357.1.12956 WP_001241357.1.12965 WP_001241357.1.12976 WP_001241357.1.12987 WP_001241357.1.12991 WP_001241357.1.13002 WP_001241357.1.13015 WP_001241357.1.13031 WP_001241357.1.13060 WP_001241357.1.13074 WP_001241357.1.1308 WP_001241357.1.13117 WP_001241357.1.1312 WP_001241357.1.13136 WP_001241357.1.1314 WP_001241357.1.13144 WP_001241357.1.13157 WP_001241357.1.13162 WP_001241357.1.13176 WP_001241357.1.13181 WP_001241357.1.13205 WP_001241357.1.13217 WP_001241357.1.13223 WP_001241357.1.1323 WP_001241357.1.13239 WP_001241357.1.13252 WP_001241357.1.13258 WP_001241357.1.13271 WP_001241357.1.13272 WP_001241357.1.13278 WP_001241357.1.13281 WP_001241357.1.13290 WP_001241357.1.13295 WP_001241357.1.13332 WP_001241357.1.13333 WP_001241357.1.13348 WP_001241357.1.13393 WP_001241357.1.13409 WP_001241357.1.1343 WP_001241357.1.13430 WP_001241357.1.13437 WP_001241357.1.13442 WP_001241357.1.1345 WP_001241357.1.13451 WP_001241357.1.13469 WP_001241357.1.13473 WP_001241357.1.13481 WP_001241357.1.13525 WP_001241357.1.13585 WP_001241357.1.13608 WP_001241357.1.13618 WP_001241357.1.13624 WP_001241357.1.13626 WP_001241357.1.13644 WP_001241357.1.13662 WP_001241357.1.13778 WP_001241357.1.13798 WP_001241357.1.13824 WP_001241357.1.13867 WP_001241357.1.13877 WP_001241357.1.13881 WP_001241357.1.13934 WP_001241357.1.13936 WP_001241357.1.13939 WP_001241357.1.13944 WP_001241357.1.13949 WP_001241357.1.13979 WP_001241357.1.14023 WP_001241357.1.14030 WP_001241357.1.14042 WP_001241357.1.14110 WP_001241357.1.14129 WP_001241357.1.14144 WP_001241357.1.14164 WP_001241357.1.1419 WP_001241357.1.14199 WP_001241357.1.14245 WP_001241357.1.14253 WP_001241357.1.14277 WP_001241357.1.14322 WP_001241357.1.14331 WP_001241357.1.14346 WP_001241357.1.14371 WP_001241357.1.1438 WP_001241357.1.14389 WP_001241357.1.14417 WP_001241357.1.14445 WP_001241357.1.14453 WP_001241357.1.14501 WP_001241357.1.14506 WP_001241357.1.14509 WP_001241357.1.14529 WP_001241357.1.14536 WP_001241357.1.14538 WP_001241357.1.14581 WP_001241357.1.14600 WP_001241357.1.14605 WP_001241357.1.14607 WP_001241357.1.1461 WP_001241357.1.14616 WP_001241357.1.14621 WP_001241357.1.14672 WP_001241357.1.14678 WP_001241357.1.14687 WP_001241357.1.1470 WP_001241357.1.14712 WP_001241357.1.14746 WP_001241357.1.14748 WP_001241357.1.14749 WP_001241357.1.14807 WP_001241357.1.14811 WP_001241357.1.14833 WP_001241357.1.14871 WP_001241357.1.14879 WP_001241357.1.14914 WP_001241357.1.14934 WP_001241357.1.14935 WP_001241357.1.14946 WP_001241357.1.14963 WP_001241357.1.14992 WP_001241357.1.14993 WP_001241357.1.15020 WP_001241357.1.15041 WP_001241357.1.15090 WP_001241357.1.15117 WP_001241357.1.1512 WP_001241357.1.15121 WP_001241357.1.15193 WP_001241357.1.15207 WP_001241357.1.15259 WP_001241357.1.15274 WP_001241357.1.15282 WP_001241357.1.15290 WP_001241357.1.15300 WP_001241357.1.15304 WP_001241357.1.15332 WP_001241357.1.15347 WP_001241357.1.15356 WP_001241357.1.15377 WP_001241357.1.15420 WP_001241357.1.1543 WP_001241357.1.15444 WP_001241357.1.15453 WP_001241357.1.15464 WP_001241357.1.15469 WP_001241357.1.15496 WP_001241357.1.1550 WP_001241357.1.15503 WP_001241357.1.15527 WP_001241357.1.15538 WP_001241357.1.15576 WP_001241357.1.15583 WP_001241357.1.1559 WP_001241357.1.1561 WP_001241357.1.15620 WP_001241357.1.15624 WP_001241357.1.15626 WP_001241357.1.15645 WP_001241357.1.15654 WP_001241357.1.15702 WP_001241357.1.15731 WP_001241357.1.15740 WP_001241357.1.15747 WP_001241357.1.15752 WP_001241357.1.15768 WP_001241357.1.15782 WP_001241357.1.15855 WP_001241357.1.15857 WP_001241357.1.15863 WP_001241357.1.15869 WP_001241357.1.1588 WP_001241357.1.15906 WP_001241357.1.15949 WP_001241357.1.15951 WP_001241357.1.15983 WP_001241357.1.15984 WP_001241357.1.15990 WP_001241357.1.16010 WP_001241357.1.16034 WP_001241357.1.1604 WP_001241357.1.16067 WP_001241357.1.16075 WP_001241357.1.16086 WP_001241357.1.16087 WP_001241357.1.1609 WP_001241357.1.16102 WP_001241357.1.16111 WP_001241357.1.16117 WP_001241357.1.16131 WP_001241357.1.16133 WP_001241357.1.16154 WP_001241357.1.16171 WP_001241357.1.16175 WP_001241357.1.16179 WP_001241357.1.16183 WP_001241357.1.1621 WP_001241357.1.1622 WP_001241357.1.16222 WP_001241357.1.16270 WP_001241357.1.16272 WP_001241357.1.16294 WP_001241357.1.16322 WP_001241357.1.1634 WP_001241357.1.16396 WP_001241357.1.16435 WP_001241357.1.16463 WP_001241357.1.16481 WP_001241357.1.16500 WP_001241357.1.16532 WP_001241357.1.16539 WP_001241357.1.16541 WP_001241357.1.16577 WP_001241357.1.16608 WP_001241357.1.16612 WP_001241357.1.16648 WP_001241357.1.16667 WP_001241357.1.16685 WP_001241357.1.16700 WP_001241357.1.16705 WP_001241357.1.16715 WP_001241357.1.16721 WP_001241357.1.16752 WP_001241357.1.16766 WP_001241357.1.16780 WP_001241357.1.16798 WP_001241357.1.16799 WP_001241357.1.16805 WP_001241357.1.16807 WP_001241357.1.16818 WP_001241357.1.16843 WP_001241357.1.16845 WP_001241357.1.16862 WP_001241357.1.16927 WP_001241357.1.16979 WP_001241357.1.16992 WP_001241357.1.17014 WP_001241357.1.17017 WP_001241357.1.17018 WP_001241357.1.17028 WP_001241357.1.17061 WP_001241357.1.17084 WP_001241357.1.17087 WP_001241357.1.1710 WP_001241357.1.17114 WP_001241357.1.17123 WP_001241357.1.17153 WP_001241357.1.17172 WP_001241357.1.17182 WP_001241357.1.17187 WP_001241357.1.17206 WP_001241357.1.17216 WP_001241357.1.17241 WP_001241357.1.17242 WP_001241357.1.17267 WP_001241357.1.17290 WP_001241357.1.17325 WP_001241357.1.17333 WP_001241357.1.17356 WP_001241357.1.17360 WP_001241357.1.17386 WP_001241357.1.17387 WP_001241357.1.17392 WP_001241357.1.17415 WP_001241357.1.17417 WP_001241357.1.17432 WP_001241357.1.17461 WP_001241357.1.17496 WP_001241357.1.17515 WP_001241357.1.17534 WP_001241357.1.1754 WP_001241357.1.1755 WP_001241357.1.17550 WP_001241357.1.17568 WP_001241357.1.17577 WP_001241357.1.17584 WP_001241357.1.17595 WP_001241357.1.1763 WP_001241357.1.17680 WP_001241357.1.17701 WP_001241357.1.17711 WP_001241357.1.1772 WP_001241357.1.17734 WP_001241357.1.17757 WP_001241357.1.17766 WP_001241357.1.17802 WP_001241357.1.17829 WP_001241357.1.17849 WP_001241357.1.17889 WP_001241357.1.17904 WP_001241357.1.17925 WP_001241357.1.17937 WP_001241357.1.17952 WP_001241357.1.17984 WP_001241357.1.18000 WP_001241357.1.18006 WP_001241357.1.1802 WP_001241357.1.18024 WP_001241357.1.18050 WP_001241357.1.18094 WP_001241357.1.18112 WP_001241357.1.18118 WP_001241357.1.18121 WP_001241357.1.18133 WP_001241357.1.18134 WP_001241357.1.18136 WP_001241357.1.18141 WP_001241357.1.18164 WP_001241357.1.18175 WP_001241357.1.1821 WP_001241357.1.18225 WP_001241357.1.18226 WP_001241357.1.18229 WP_001241357.1.18275 WP_001241357.1.18316 WP_001241357.1.18326 WP_001241357.1.18329 WP_001241357.1.18337 WP_001241357.1.1834 WP_001241357.1.18340 WP_001241357.1.18348 WP_001241357.1.18381 WP_001241357.1.18383 WP_001241357.1.18394 WP_001241357.1.18402 WP_001241357.1.18410 WP_001241357.1.18420 WP_001241357.1.18428 WP_001241357.1.18461 WP_001241357.1.18472 WP_001241357.1.18482 WP_001241357.1.18519 WP_001241357.1.18550 WP_001241357.1.18556 WP_001241357.1.18581 WP_001241357.1.18588 WP_001241357.1.1861 WP_001241357.1.18617 WP_001241357.1.1862 WP_001241357.1.18649 WP_001241357.1.18651 WP_001241357.1.18655 WP_001241357.1.18666 WP_001241357.1.1867 WP_001241357.1.18699 WP_001241357.1.18725 WP_001241357.1.18726 WP_001241357.1.1873 WP_001241357.1.18734 WP_001241357.1.18794 WP_001241357.1.188 WP_001241357.1.18801 WP_001241357.1.18802 WP_001241357.1.1881 WP_001241357.1.18828 WP_001241357.1.18837 WP_001241357.1.18843 WP_001241357.1.18858 WP_001241357.1.18874 WP_001241357.1.18876 WP_001241357.1.18908 WP_001241357.1.18923 WP_001241357.1.18929 WP_001241357.1.18934 WP_001241357.1.1896 WP_001241357.1.18962 WP_001241357.1.18966 WP_001241357.1.18995 WP_001241357.1.19024 WP_001241357.1.19036 WP_001241357.1.19039 WP_001241357.1.19090 WP_001241357.1.191 WP_001241357.1.19100 WP_001241357.1.19114 WP_001241357.1.19129 WP_001241357.1.19135 WP_001241357.1.19140 WP_001241357.1.19146 WP_001241357.1.19147 WP_001241357.1.19148 WP_001241357.1.19150 WP_001241357.1.19153 WP_001241357.1.19171 WP_001241357.1.19194 WP_001241357.1.19205 WP_001241357.1.19206 WP_001241357.1.19245 WP_001241357.1.1925 WP_001241357.1.19276 WP_001241357.1.19277 WP_001241357.1.19297 WP_001241357.1.193 WP_001241357.1.19312 WP_001241357.1.19313 WP_001241357.1.19314 WP_001241357.1.19347 WP_001241357.1.19350 WP_001241357.1.19374 WP_001241357.1.19379 WP_001241357.1.19389 WP_001241357.1.19397 WP_001241357.1.19419 WP_001241357.1.19441 WP_001241357.1.19448 WP_001241357.1.19453 WP_001241357.1.19465 WP_001241357.1.19478 WP_001241357.1.19492 WP_001241357.1.1952 WP_001241357.1.19534 WP_001241357.1.19547 WP_001241357.1.19557 WP_001241357.1.19581 WP_001241357.1.19593 WP_001241357.1.1960 WP_001241357.1.1963 WP_001241357.1.19644 WP_001241357.1.19649 WP_001241357.1.19651 WP_001241357.1.19654 WP_001241357.1.19655 WP_001241357.1.19661 WP_001241357.1.19684 WP_001241357.1.19691 WP_001241357.1.19760 WP_001241357.1.19761 WP_001241357.1.1982 WP_001241357.1.19830 WP_001241357.1.19840 WP_001241357.1.19847 WP_001241357.1.19861 WP_001241357.1.1987 WP_001241357.1.19889 WP_001241357.1.19940 WP_001241357.1.19957 WP_001241357.1.19972 WP_001241357.1.19994 WP_001241357.1.2005 WP_001241357.1.20115 WP_001241357.1.20133 WP_001241357.1.20136 WP_001241357.1.2015 WP_001241357.1.20151 WP_001241357.1.20159 WP_001241357.1.20164 WP_001241357.1.20170 WP_001241357.1.20183 WP_001241357.1.20224 WP_001241357.1.20238 WP_001241357.1.2027 WP_001241357.1.20277 WP_001241357.1.20289 WP_001241357.1.20318 WP_001241357.1.20331 WP_001241357.1.20388 WP_001241357.1.20445 WP_001241357.1.20449 WP_001241357.1.20452 WP_001241357.1.20480 WP_001241357.1.20484 WP_001241357.1.20493 WP_001241357.1.20506 WP_001241357.1.20515 WP_001241357.1.20536 WP_001241357.1.20546 WP_001241357.1.20565 WP_001241357.1.20575 WP_001241357.1.20594 WP_001241357.1.20596 WP_001241357.1.20609 WP_001241357.1.20630 WP_001241357.1.20638 WP_001241357.1.20640 WP_001241357.1.20662 WP_001241357.1.20709 WP_001241357.1.20724 WP_001241357.1.20730 WP_001241357.1.20737 WP_001241357.1.20741 WP_001241357.1.20745 WP_001241357.1.2075 WP_001241357.1.20761 WP_001241357.1.20765 WP_001241357.1.20784 WP_001241357.1.20803 WP_001241357.1.20818 WP_001241357.1.20824 WP_001241357.1.20841 WP_001241357.1.20863 WP_001241357.1.2089 WP_001241357.1.20893 WP_001241357.1.20907 WP_001241357.1.2092 WP_001241357.1.20933 WP_001241357.1.2094 WP_001241357.1.20941 WP_001241357.1.20943 WP_001241357.1.20950 WP_001241357.1.20962 WP_001241357.1.20982 WP_001241357.1.20989 WP_001241357.1.2100 WP_001241357.1.21017 WP_001241357.1.21020 WP_001241357.1.21024 WP_001241357.1.21029 WP_001241357.1.21033 WP_001241357.1.21057 WP_001241357.1.21122 WP_001241357.1.21152 WP_001241357.1.21236 WP_001241357.1.21248 WP_001241357.1.21251 WP_001241357.1.21255 WP_001241357.1.21266 WP_001241357.1.21378 WP_001241357.1.2142 WP_001241357.1.21450 WP_001241357.1.21455 WP_001241357.1.21470 WP_001241357.1.21508 WP_001241357.1.21519 WP_001241357.1.21526 WP_001241357.1.21537 WP_001241357.1.2156 WP_001241357.1.21573 WP_001241357.1.21596 WP_001241357.1.21614 WP_001241357.1.21634 WP_001241357.1.2164 WP_001241357.1.21652 WP_001241357.1.21661 WP_001241357.1.21666 WP_001241357.1.21668 WP_001241357.1.21714 WP_001241357.1.21729 WP_001241357.1.21733 WP_001241357.1.21756 WP_001241357.1.21758 WP_001241357.1.21771 WP_001241357.1.21773 WP_001241357.1.21812 WP_001241357.1.21823 WP_001241357.1.21887 WP_001241357.1.21899 WP_001241357.1.21948 WP_001241357.1.21962 WP_001241357.1.2198 WP_001241357.1.21986 WP_001241357.1.21992 WP_001241357.1.22021 WP_001241357.1.22042 WP_001241357.1.22060 WP_001241357.1.22088 WP_001241357.1.22098 WP_001241357.1.22113 WP_001241357.1.22161 WP_001241357.1.2218 WP_001241357.1.22182 WP_001241357.1.22189 WP_001241357.1.22195 WP_001241357.1.22203 WP_001241357.1.22251 WP_001241357.1.22272 WP_001241357.1.22280 WP_001241357.1.22293 WP_001241357.1.22304 WP_001241357.1.22314 WP_001241357.1.22325 WP_001241357.1.22328 WP_001241357.1.22363 WP_001241357.1.22381 WP_001241357.1.22409 WP_001241357.1.2242 WP_001241357.1.22431 WP_001241357.1.2245 WP_001241357.1.22450 WP_001241357.1.22464 WP_001241357.1.22508 WP_001241357.1.22522 WP_001241357.1.22543 WP_001241357.1.22549 WP_001241357.1.22572 WP_001241357.1.22574 WP_001241357.1.22576 WP_001241357.1.22579 WP_001241357.1.22594 WP_001241357.1.22599 WP_001241357.1.22602 WP_001241357.1.22632 WP_001241357.1.22649 WP_001241357.1.22662 WP_001241357.1.22667 WP_001241357.1.22669 WP_001241357.1.22685 WP_001241357.1.22690 WP_001241357.1.22691 WP_001241357.1.22743 WP_001241357.1.22756 WP_001241357.1.22757 WP_001241357.1.22759 WP_001241357.1.22765 WP_001241357.1.22771 WP_001241357.1.22814 WP_001241357.1.22824 WP_001241357.1.22830 WP_001241357.1.22875 WP_001241357.1.22878 WP_001241357.1.22885 WP_001241357.1.22896 WP_001241357.1.22917 WP_001241357.1.22925 WP_001241357.1.22939 WP_001241357.1.22988 WP_001241357.1.22993 WP_001241357.1.2300 WP_001241357.1.23021 WP_001241357.1.23042 WP_001241357.1.23044 WP_001241357.1.23073 WP_001241357.1.23090 WP_001241357.1.23092 WP_001241357.1.23105 WP_001241357.1.23109 WP_001241357.1.23115 WP_001241357.1.23135 WP_001241357.1.2322 WP_001241357.1.23230 WP_001241357.1.23241 WP_001241357.1.2325 WP_001241357.1.23282 WP_001241357.1.23285 WP_001241357.1.23290 WP_001241357.1.23299 WP_001241357.1.23323 WP_001241357.1.23330 WP_001241357.1.23351 WP_001241357.1.23355 WP_001241357.1.23376 WP_001241357.1.23378 WP_001241357.1.23383 WP_001241357.1.23386 WP_001241357.1.23393 WP_001241357.1.23435 WP_001241357.1.23467 WP_001241357.1.23511 WP_001241357.1.23522 WP_001241357.1.23549 WP_001241357.1.23575 WP_001241357.1.23622 WP_001241357.1.23625 WP_001241357.1.23640 WP_001241357.1.23686 WP_001241357.1.23700 WP_001241357.1.23711 WP_001241357.1.23724 WP_001241357.1.23752 WP_001241357.1.23765 WP_001241357.1.23790 WP_001241357.1.23804 WP_001241357.1.23806 WP_001241357.1.23812 WP_001241357.1.23838 WP_001241357.1.23840 WP_001241357.1.23855 WP_001241357.1.23869 WP_001241357.1.2388 WP_001241357.1.23890 WP_001241357.1.23895 WP_001241357.1.23898 WP_001241357.1.23899 WP_001241357.1.23945 WP_001241357.1.2395 WP_001241357.1.23950 WP_001241357.1.23953 WP_001241357.1.23960 WP_001241357.1.23962 WP_001241357.1.23970 WP_001241357.1.23973 WP_001241357.1.23984 WP_001241357.1.23985 WP_001241357.1.24004 WP_001241357.1.24038 WP_001241357.1.24045 WP_001241357.1.24070 WP_001241357.1.24088 WP_001241357.1.24089 WP_001241357.1.24122 WP_001241357.1.24127 WP_001241357.1.2413 WP_001241357.1.24169 WP_001241357.1.24170 WP_001241357.1.24177 WP_001241357.1.2418 WP_001241357.1.24233 WP_001241357.1.2428 WP_001241357.1.24283 WP_001241357.1.2430 WP_001241357.1.24304 WP_001241357.1.24316 WP_001241357.1.2433 WP_001241357.1.24341 WP_001241357.1.24362 WP_001241357.1.24381 WP_001241357.1.24383 WP_001241357.1.24458 WP_001241357.1.2449 WP_001241357.1.24523 WP_001241357.1.24524 WP_001241357.1.24536 WP_001241357.1.24547 WP_001241357.1.24575 WP_001241357.1.24577 WP_001241357.1.24583 WP_001241357.1.24592 WP_001241357.1.24616 WP_001241357.1.24634 WP_001241357.1.24642 WP_001241357.1.24650 WP_001241357.1.2469 WP_001241357.1.24693 WP_001241357.1.24695 WP_001241357.1.24703 WP_001241357.1.24753 WP_001241357.1.24758 WP_001241357.1.24763 WP_001241357.1.24773 WP_001241357.1.2479 WP_001241357.1.24797 WP_001241357.1.24808 WP_001241357.1.24854 WP_001241357.1.24870 WP_001241357.1.24876 WP_001241357.1.24899 WP_001241357.1.24906 WP_001241357.1.24909 WP_001241357.1.24926 WP_001241357.1.24929 WP_001241357.1.24960 WP_001241357.1.24968 WP_001241357.1.24979 WP_001241357.1.24984 WP_001241357.1.2502 WP_001241357.1.25021 WP_001241357.1.25038 WP_001241357.1.2504 WP_001241357.1.25042 WP_001241357.1.25050 WP_001241357.1.25076 WP_001241357.1.25079 WP_001241357.1.25082 WP_001241357.1.25085 WP_001241357.1.25087 WP_001241357.1.25088 WP_001241357.1.2512 WP_001241357.1.25141 WP_001241357.1.25174 WP_001241357.1.25183 WP_001241357.1.25193 WP_001241357.1.25201 WP_001241357.1.25203 WP_001241357.1.25204 WP_001241357.1.25248 WP_001241357.1.25270 WP_001241357.1.25272 WP_001241357.1.25305 WP_001241357.1.2531 WP_001241357.1.25312 WP_001241357.1.25324 WP_001241357.1.25372 WP_001241357.1.25380 WP_001241357.1.2540 WP_001241357.1.25414 WP_001241357.1.25420 WP_001241357.1.25446 WP_001241357.1.25480 WP_001241357.1.25525 WP_001241357.1.25526 WP_001241357.1.25548 WP_001241357.1.25577 WP_001241357.1.25612 WP_001241357.1.25631 WP_001241357.1.25643 WP_001241357.1.2567 WP_001241357.1.25680 WP_001241357.1.25701 WP_001241357.1.25712 WP_001241357.1.25713 WP_001241357.1.25724 WP_001241357.1.25726 WP_001241357.1.25750 WP_001241357.1.25794 WP_001241357.1.25799 WP_001241357.1.25819 WP_001241357.1.25831 WP_001241357.1.25843 WP_001241357.1.25869 WP_001241357.1.25873 WP_001241357.1.25890 WP_001241357.1.25895 WP_001241357.1.25945 WP_001241357.1.2597 WP_001241357.1.26005 WP_001241357.1.26040 WP_001241357.1.26048 WP_001241357.1.2606 WP_001241357.1.26061 WP_001241357.1.26066 WP_001241357.1.26076 WP_001241357.1.26092 WP_001241357.1.26105 WP_001241357.1.26121 WP_001241357.1.26125 WP_001241357.1.26131 WP_001241357.1.26134 WP_001241357.1.26150 WP_001241357.1.26161 WP_001241357.1.26175 WP_001241357.1.26189 WP_001241357.1.26196 WP_001241357.1.26246 WP_001241357.1.26259 WP_001241357.1.26262 WP_001241357.1.26270 WP_001241357.1.26284 WP_001241357.1.26304 WP_001241357.1.2637 WP_001241357.1.26379 WP_001241357.1.26398 WP_001241357.1.26401 WP_001241357.1.26403 WP_001241357.1.26419 WP_001241357.1.2642 WP_001241357.1.26438 WP_001241357.1.26443 WP_001241357.1.26474 WP_001241357.1.26480 WP_001241357.1.26517 WP_001241357.1.26525 WP_001241357.1.26569 WP_001241357.1.26574 WP_001241357.1.26579 WP_001241357.1.26588 WP_001241357.1.26590 WP_001241357.1.26609 WP_001241357.1.26613 WP_001241357.1.26627 WP_001241357.1.26644 WP_001241357.1.2665 WP_001241357.1.26658 WP_001241357.1.26659 WP_001241357.1.26660 WP_001241357.1.26688 WP_001241357.1.26716 WP_001241357.1.26736 WP_001241357.1.26761 WP_001241357.1.26782 WP_001241357.1.26837 WP_001241357.1.26839 WP_001241357.1.26861 WP_001241357.1.26878 WP_001241357.1.2688 WP_001241357.1.26932 WP_001241357.1.2694 WP_001241357.1.26941 WP_001241357.1.26943 WP_001241357.1.26950 WP_001241357.1.26975 WP_001241357.1.26987 WP_001241357.1.26995 WP_001241357.1.26998 WP_001241357.1.2700 WP_001241357.1.27043 WP_001241357.1.27057 WP_001241357.1.27060 WP_001241357.1.27091 WP_001241357.1.27101 WP_001241357.1.27134 WP_001241357.1.27141 WP_001241357.1.27175 WP_001241357.1.27188 WP_001241357.1.27234 WP_001241357.1.27260 WP_001241357.1.27280 WP_001241357.1.27283 WP_001241357.1.27310 WP_001241357.1.27313 WP_001241357.1.27330 WP_001241357.1.27338 WP_001241357.1.27367 WP_001241357.1.27373 WP_001241357.1.27396 WP_001241357.1.27401 WP_001241357.1.27426 WP_001241357.1.27445 WP_001241357.1.2745 WP_001241357.1.27472 WP_001241357.1.27504 WP_001241357.1.27518 WP_001241357.1.27520 WP_001241357.1.27524 WP_001241357.1.2755 WP_001241357.1.27560 WP_001241357.1.27585 WP_001241357.1.27611 WP_001241357.1.27618 WP_001241357.1.27693 WP_001241357.1.27723 WP_001241357.1.27734 WP_001241357.1.27742 WP_001241357.1.27758 WP_001241357.1.27774 WP_001241357.1.2779 WP_001241357.1.27797 WP_001241357.1.2782 WP_001241357.1.27846 WP_001241357.1.27856 WP_001241357.1.27861 WP_001241357.1.27871 WP_001241357.1.27876 WP_001241357.1.27879 WP_001241357.1.27913 WP_001241357.1.27923 WP_001241357.1.27932 WP_001241357.1.2794 WP_001241357.1.27957 WP_001241357.1.27971 WP_001241357.1.27998 WP_001241357.1.28008 WP_001241357.1.28026 WP_001241357.1.28027 WP_001241357.1.28046 WP_001241357.1.28051 WP_001241357.1.28102 WP_001241357.1.2811 WP_001241357.1.28110 WP_001241357.1.28128 WP_001241357.1.28143 WP_001241357.1.28145 WP_001241357.1.28156 WP_001241357.1.28167 WP_001241357.1.28184 WP_001241357.1.28199 WP_001241357.1.2823 WP_001241357.1.28250 WP_001241357.1.28268 WP_001241357.1.28271 WP_001241357.1.28314 WP_001241357.1.28318 WP_001241357.1.28322 WP_001241357.1.28345 WP_001241357.1.28349 WP_001241357.1.28371 WP_001241357.1.2838 WP_001241357.1.28401 WP_001241357.1.28461 WP_001241357.1.28476 WP_001241357.1.28491 WP_001241357.1.28496 WP_001241357.1.285 WP_001241357.1.28500 WP_001241357.1.28509 WP_001241357.1.28536 WP_001241357.1.28544 WP_001241357.1.28551 WP_001241357.1.28568 WP_001241357.1.28639 WP_001241357.1.2866 WP_001241357.1.28662 WP_001241357.1.28683 WP_001241357.1.28697 WP_001241357.1.28711 WP_001241357.1.28723 WP_001241357.1.28732 WP_001241357.1.28734 WP_001241357.1.28736 WP_001241357.1.28742 WP_001241357.1.28760 WP_001241357.1.28809 WP_001241357.1.28829 WP_001241357.1.28842 WP_001241357.1.28863 WP_001241357.1.28879 WP_001241357.1.28919 WP_001241357.1.28924 WP_001241357.1.28982 WP_001241357.1.28994 WP_001241357.1.290 WP_001241357.1.29001 WP_001241357.1.29013 WP_001241357.1.29016 WP_001241357.1.29026 WP_001241357.1.29049 WP_001241357.1.29061 WP_001241357.1.291 WP_001241357.1.29100 WP_001241357.1.29125 WP_001241357.1.29126 WP_001241357.1.29128 WP_001241357.1.29150 WP_001241357.1.29164 WP_001241357.1.29221 WP_001241357.1.29230 WP_001241357.1.29258 WP_001241357.1.2926 WP_001241357.1.2931 WP_001241357.1.29341 WP_001241357.1.29377 WP_001241357.1.29394 WP_001241357.1.29404 WP_001241357.1.2942 WP_001241357.1.29429 WP_001241357.1.29443 WP_001241357.1.2945 WP_001241357.1.29486 WP_001241357.1.29495 WP_001241357.1.29497 WP_001241357.1.29513 WP_001241357.1.29523 WP_001241357.1.2954 WP_001241357.1.29564 WP_001241357.1.29590 WP_001241357.1.29597 WP_001241357.1.29603 WP_001241357.1.29618 WP_001241357.1.2963 WP_001241357.1.29647 WP_001241357.1.29662 WP_001241357.1.29683 WP_001241357.1.29689 WP_001241357.1.29752 WP_001241357.1.2978 WP_001241357.1.29815 WP_001241357.1.29818 WP_001241357.1.29819 WP_001241357.1.29820 WP_001241357.1.29821 WP_001241357.1.29840 WP_001241357.1.29855 WP_001241357.1.29874 WP_001241357.1.29884 WP_001241357.1.2995 WP_001241357.1.29967 WP_001241357.1.29976 WP_001241357.1.29979 WP_001241357.1.29988 WP_001241357.1.29992 WP_001241357.1.30 WP_001241357.1.30004 WP_001241357.1.30019 WP_001241357.1.30052 WP_001241357.1.30063 WP_001241357.1.30064 WP_001241357.1.30098 WP_001241357.1.30105 WP_001241357.1.30123 WP_001241357.1.30164 WP_001241357.1.3018 WP_001241357.1.30231 WP_001241357.1.30232 WP_001241357.1.30239 WP_001241357.1.30247 WP_001241357.1.30253 WP_001241357.1.30269 WP_001241357.1.30298 WP_001241357.1.30397 WP_001241357.1.30399 WP_001241357.1.30400 WP_001241357.1.30428 WP_001241357.1.30447 WP_001241357.1.30452 WP_001241357.1.30472 WP_001241357.1.30476 WP_001241357.1.30479 WP_001241357.1.30497 WP_001241357.1.30524 WP_001241357.1.30536 WP_001241357.1.30546 WP_001241357.1.3055 WP_001241357.1.30550 WP_001241357.1.30570 WP_001241357.1.306 WP_001241357.1.30630 WP_001241357.1.30637 WP_001241357.1.30639 WP_001241357.1.30640 WP_001241357.1.30658 WP_001241357.1.30665 WP_001241357.1.30691 WP_001241357.1.30733 WP_001241357.1.30749 WP_001241357.1.30762 WP_001241357.1.30783 WP_001241357.1.30808 WP_001241357.1.3083 WP_001241357.1.30843 WP_001241357.1.30867 WP_001241357.1.30879 WP_001241357.1.30887 WP_001241357.1.30896 WP_001241357.1.309 WP_001241357.1.30905 WP_001241357.1.30906 WP_001241357.1.30918 WP_001241357.1.30987 WP_001241357.1.30993 WP_001241357.1.30999 WP_001241357.1.31017 WP_001241357.1.31029 WP_001241357.1.31055 WP_001241357.1.31083 WP_001241357.1.31089 WP_001241357.1.31119 WP_001241357.1.31129 WP_001241357.1.31142 WP_001241357.1.31149 WP_001241357.1.31154 WP_001241357.1.31188 WP_001241357.1.312 WP_001241357.1.31211 WP_001241357.1.31252 WP_001241357.1.31295 WP_001241357.1.31379 WP_001241357.1.3140 WP_001241357.1.31401 WP_001241357.1.31421 WP_001241357.1.31422 WP_001241357.1.31431 WP_001241357.1.31433 WP_001241357.1.3147 WP_001241357.1.31506 WP_001241357.1.31509 WP_001241357.1.31511 WP_001241357.1.31542 WP_001241357.1.31557 WP_001241357.1.31559 WP_001241357.1.31575 WP_001241357.1.31596 WP_001241357.1.31614 WP_001241357.1.31657 WP_001241357.1.31675 WP_001241357.1.3169 WP_001241357.1.31715 WP_001241357.1.3176 WP_001241357.1.31809 WP_001241357.1.31823 WP_001241357.1.31825 WP_001241357.1.31833 WP_001241357.1.31835 WP_001241357.1.31839 WP_001241357.1.31863 WP_001241357.1.31928 WP_001241357.1.31956 WP_001241357.1.31978 WP_001241357.1.3201 WP_001241357.1.32020 WP_001241357.1.32021 WP_001241357.1.32024 WP_001241357.1.3203 WP_001241357.1.32030 WP_001241357.1.32063 WP_001241357.1.32093 WP_001241357.1.32094 WP_001241357.1.32121 WP_001241357.1.32127 WP_001241357.1.32143 WP_001241357.1.3215 WP_001241357.1.32184 WP_001241357.1.322 WP_001241357.1.32222 WP_001241357.1.32225 WP_001241357.1.32234 WP_001241357.1.32243 WP_001241357.1.3233 WP_001241357.1.32406 WP_001241357.1.32432 WP_001241357.1.32443 WP_001241357.1.32478 WP_001241357.1.32479 WP_001241357.1.32480 WP_001241357.1.32494 WP_001241357.1.32509 WP_001241357.1.32518 WP_001241357.1.32536 WP_001241357.1.32558 WP_001241357.1.32561 WP_001241357.1.32574 WP_001241357.1.32587 WP_001241357.1.3259 WP_001241357.1.32590 WP_001241357.1.32591 WP_001241357.1.32650 WP_001241357.1.32676 WP_001241357.1.32680 WP_001241357.1.3269 WP_001241357.1.32718 WP_001241357.1.32724 WP_001241357.1.32748 WP_001241357.1.32772 WP_001241357.1.32815 WP_001241357.1.32835 WP_001241357.1.32888 WP_001241357.1.32903 WP_001241357.1.32910 WP_001241357.1.32931 WP_001241357.1.32938 WP_001241357.1.32946 WP_001241357.1.3295 WP_001241357.1.32972 WP_001241357.1.32984 WP_001241357.1.32992 WP_001241357.1.33004 WP_001241357.1.33014 WP_001241357.1.33022 WP_001241357.1.33026 WP_001241357.1.33046 WP_001241357.1.33049 WP_001241357.1.33055 WP_001241357.1.33094 WP_001241357.1.33101 WP_001241357.1.33119 WP_001241357.1.33125 WP_001241357.1.33146 WP_001241357.1.33167 WP_001241357.1.33178 WP_001241357.1.33179 WP_001241357.1.33190 WP_001241357.1.33217 WP_001241357.1.33222 WP_001241357.1.33238 WP_001241357.1.33244 WP_001241357.1.33268 WP_001241357.1.33303 WP_001241357.1.33325 WP_001241357.1.33341 WP_001241357.1.33352 WP_001241357.1.33369 WP_001241357.1.33385 WP_001241357.1.33408 WP_001241357.1.33410 WP_001241357.1.33424 WP_001241357.1.33428 WP_001241357.1.3344 WP_001241357.1.33475 WP_001241357.1.33476 WP_001241357.1.33502 WP_001241357.1.33525 WP_001241357.1.33526 WP_001241357.1.33545 WP_001241357.1.33563 WP_001241357.1.33565 WP_001241357.1.33584 WP_001241357.1.33648 WP_001241357.1.33667 WP_001241357.1.33736 WP_001241357.1.33746 WP_001241357.1.33823 WP_001241357.1.33853 WP_001241357.1.33854 WP_001241357.1.33879 WP_001241357.1.33888 WP_001241357.1.33896 WP_001241357.1.33948 WP_001241357.1.33952 WP_001241357.1.33974 WP_001241357.1.3398 WP_001241357.1.33981 WP_001241357.1.3401 WP_001241357.1.34032 WP_001241357.1.34117 WP_001241357.1.34121 WP_001241357.1.34124 WP_001241357.1.34130 WP_001241357.1.34144 WP_001241357.1.342 WP_001241357.1.34204 WP_001241357.1.34206 WP_001241357.1.34208 WP_001241357.1.34224 WP_001241357.1.34269 WP_001241357.1.34277 WP_001241357.1.34294 WP_001241357.1.34303 WP_001241357.1.3432 WP_001241357.1.34332 WP_001241357.1.34341 WP_001241357.1.34348 WP_001241357.1.34362 WP_001241357.1.34363 WP_001241357.1.34383 WP_001241357.1.3439 WP_001241357.1.34422 WP_001241357.1.34441 WP_001241357.1.34444 WP_001241357.1.34456 WP_001241357.1.34464 WP_001241357.1.34470 WP_001241357.1.34500 WP_001241357.1.34528 WP_001241357.1.34532 WP_001241357.1.34538 WP_001241357.1.34558 WP_001241357.1.3460 WP_001241357.1.34605 WP_001241357.1.34617 WP_001241357.1.34675 WP_001241357.1.34680 WP_001241357.1.34683 WP_001241357.1.34686 WP_001241357.1.3469 WP_001241357.1.347 WP_001241357.1.3472 WP_001241357.1.34727 WP_001241357.1.34763 WP_001241357.1.34782 WP_001241357.1.34835 WP_001241357.1.34838 WP_001241357.1.34875 WP_001241357.1.34913 WP_001241357.1.34931 WP_001241357.1.34948 WP_001241357.1.34966 WP_001241357.1.34982 WP_001241357.1.34990 WP_001241357.1.34993 WP_001241357.1.35003 WP_001241357.1.35007 WP_001241357.1.35012 WP_001241357.1.35039 WP_001241357.1.35107 WP_001241357.1.35127 WP_001241357.1.35132 WP_001241357.1.3515 WP_001241357.1.35168 WP_001241357.1.35195 WP_001241357.1.35198 WP_001241357.1.35202 WP_001241357.1.35204 WP_001241357.1.35208 WP_001241357.1.35211 WP_001241357.1.35220 WP_001241357.1.35253 WP_001241357.1.35258 WP_001241357.1.35328 WP_001241357.1.35349 WP_001241357.1.35360 WP_001241357.1.35365 WP_001241357.1.35368 WP_001241357.1.35376 WP_001241357.1.35393 WP_001241357.1.35394 WP_001241357.1.35448 WP_001241357.1.35464 WP_001241357.1.35465 WP_001241357.1.35466 WP_001241357.1.35468 WP_001241357.1.35483 WP_001241357.1.3550 WP_001241357.1.35578 WP_001241357.1.35581 WP_001241357.1.3560 WP_001241357.1.35627 WP_001241357.1.35632 WP_001241357.1.35649 WP_001241357.1.35651 WP_001241357.1.35698 WP_001241357.1.35704 WP_001241357.1.35724 WP_001241357.1.35741 WP_001241357.1.35744 WP_001241357.1.35789 WP_001241357.1.35889 WP_001241357.1.35904 WP_001241357.1.35934 WP_001241357.1.35959 WP_001241357.1.35963 WP_001241357.1.3598 WP_001241357.1.35985 WP_001241357.1.35987 WP_001241357.1.3600 WP_001241357.1.36010 WP_001241357.1.36042 WP_001241357.1.36085 WP_001241357.1.36105 WP_001241357.1.36129 WP_001241357.1.36132 WP_001241357.1.36158 WP_001241357.1.36164 WP_001241357.1.36182 WP_001241357.1.3620 WP_001241357.1.36207 WP_001241357.1.36212 WP_001241357.1.3624 WP_001241357.1.36332 WP_001241357.1.36334 WP_001241357.1.36352 WP_001241357.1.36386 WP_001241357.1.36393 WP_001241357.1.36405 WP_001241357.1.36414 WP_001241357.1.3643 WP_001241357.1.36453 WP_001241357.1.36459 WP_001241357.1.36496 WP_001241357.1.365 WP_001241357.1.36523 WP_001241357.1.36545 WP_001241357.1.36610 WP_001241357.1.36626 WP_001241357.1.36627 WP_001241357.1.36667 WP_001241357.1.3668 WP_001241357.1.36699 WP_001241357.1.3671 WP_001241357.1.36724 WP_001241357.1.36739 WP_001241357.1.36746 WP_001241357.1.36747 WP_001241357.1.36761 WP_001241357.1.36767 WP_001241357.1.36786 WP_001241357.1.36799 WP_001241357.1.36812 WP_001241357.1.36817 WP_001241357.1.36856 WP_001241357.1.36886 WP_001241357.1.36904 WP_001241357.1.3697 WP_001241357.1.36975 WP_001241357.1.37020 WP_001241357.1.37032 WP_001241357.1.37049 WP_001241357.1.37057 WP_001241357.1.37102 WP_001241357.1.37103 WP_001241357.1.37122 WP_001241357.1.37155 WP_001241357.1.37206 WP_001241357.1.37226 WP_001241357.1.3723 WP_001241357.1.37233 WP_001241357.1.37261 WP_001241357.1.37266 WP_001241357.1.37290 WP_001241357.1.37306 WP_001241357.1.37312 WP_001241357.1.37313 WP_001241357.1.37329 WP_001241357.1.37334 WP_001241357.1.37337 WP_001241357.1.37342 WP_001241357.1.37360 WP_001241357.1.37372 WP_001241357.1.37388 WP_001241357.1.37423 WP_001241357.1.37445 WP_001241357.1.37472 WP_001241357.1.37476 WP_001241357.1.37477 WP_001241357.1.37485 WP_001241357.1.37544 WP_001241357.1.37548 WP_001241357.1.37549 WP_001241357.1.37550 WP_001241357.1.37576 WP_001241357.1.37588 WP_001241357.1.37592 WP_001241357.1.37608 WP_001241357.1.3762 WP_001241357.1.37637 WP_001241357.1.37664 WP_001241357.1.37730 WP_001241357.1.37731 WP_001241357.1.37736 WP_001241357.1.37745 WP_001241357.1.37762 WP_001241357.1.37766 WP_001241357.1.37769 WP_001241357.1.37817 WP_001241357.1.37830 WP_001241357.1.37847 WP_001241357.1.37853 WP_001241357.1.3788 WP_001241357.1.37897 WP_001241357.1.37923 WP_001241357.1.3795 WP_001241357.1.3796 WP_001241357.1.37962 WP_001241357.1.37964 WP_001241357.1.37967 WP_001241357.1.37984 WP_001241357.1.37998 WP_001241357.1.38000 WP_001241357.1.38043 WP_001241357.1.38050 WP_001241357.1.38063 WP_001241357.1.38080 WP_001241357.1.38085 WP_001241357.1.38105 WP_001241357.1.38107 WP_001241357.1.3811 WP_001241357.1.38119 WP_001241357.1.3815 WP_001241357.1.38155 WP_001241357.1.38162 WP_001241357.1.38182 WP_001241357.1.38185 WP_001241357.1.38194 WP_001241357.1.38202 WP_001241357.1.38211 WP_001241357.1.38234 WP_001241357.1.38293 WP_001241357.1.38300 WP_001241357.1.38306 WP_001241357.1.38314 WP_001241357.1.38323 WP_001241357.1.38357 WP_001241357.1.38369 WP_001241357.1.38371 WP_001241357.1.38392 WP_001241357.1.38485 WP_001241357.1.38533 WP_001241357.1.38561 WP_001241357.1.38567 WP_001241357.1.38584 WP_001241357.1.38636 WP_001241357.1.38751 WP_001241357.1.38782 WP_001241357.1.38835 WP_001241357.1.389 WP_001241357.1.38911 WP_001241357.1.38920 WP_001241357.1.38935 WP_001241357.1.38937 WP_001241357.1.38956 WP_001241357.1.38958 WP_001241357.1.39037 WP_001241357.1.3904 WP_001241357.1.39063 WP_001241357.1.3912 WP_001241357.1.39148 WP_001241357.1.39150 WP_001241357.1.39164 WP_001241357.1.39167 WP_001241357.1.39180 WP_001241357.1.39196 WP_001241357.1.39209 WP_001241357.1.3922 WP_001241357.1.39232 WP_001241357.1.39249 WP_001241357.1.39254 WP_001241357.1.39268 WP_001241357.1.39286 WP_001241357.1.39289 WP_001241357.1.39305 WP_001241357.1.39310 WP_001241357.1.39313 WP_001241357.1.39325 WP_001241357.1.39327 WP_001241357.1.39335 WP_001241357.1.39342 WP_001241357.1.39356 WP_001241357.1.39358 WP_001241357.1.39365 WP_001241357.1.39367 WP_001241357.1.39377 WP_001241357.1.39401 WP_001241357.1.39402 WP_001241357.1.39415 WP_001241357.1.39423 WP_001241357.1.39430 WP_001241357.1.39492 WP_001241357.1.39531 WP_001241357.1.3954 WP_001241357.1.39541 WP_001241357.1.39564 WP_001241357.1.39575 WP_001241357.1.39594 WP_001241357.1.39601 WP_001241357.1.39606 WP_001241357.1.39626 WP_001241357.1.39636 WP_001241357.1.39646 WP_001241357.1.39651 WP_001241357.1.39690 WP_001241357.1.39708 WP_001241357.1.39709 WP_001241357.1.39713 WP_001241357.1.39717 WP_001241357.1.39726 WP_001241357.1.39733 WP_001241357.1.39734 WP_001241357.1.39780 WP_001241357.1.39796 WP_001241357.1.3980 WP_001241357.1.39809 WP_001241357.1.39818 WP_001241357.1.39820 WP_001241357.1.39829 WP_001241357.1.39867 WP_001241357.1.39870 WP_001241357.1.39892 WP_001241357.1.39938 WP_001241357.1.39961 WP_001241357.1.39966 WP_001241357.1.39970 WP_001241357.1.39973 WP_001241357.1.39992 WP_001241357.1.40 WP_001241357.1.40013 WP_001241357.1.40019 WP_001241357.1.4005 WP_001241357.1.40083 WP_001241357.1.40088 WP_001241357.1.40107 WP_001241357.1.40113 WP_001241357.1.40140 WP_001241357.1.40147 WP_001241357.1.40153 WP_001241357.1.40190 WP_001241357.1.40192 WP_001241357.1.40211 WP_001241357.1.40212 WP_001241357.1.40234 WP_001241357.1.40238 WP_001241357.1.40298 WP_001241357.1.4030 WP_001241357.1.40300 WP_001241357.1.40317 WP_001241357.1.40335 WP_001241357.1.40345 WP_001241357.1.40349 WP_001241357.1.40360 WP_001241357.1.40389 WP_001241357.1.40391 WP_001241357.1.40486 WP_001241357.1.40499 WP_001241357.1.40502 WP_001241357.1.40524 WP_001241357.1.40539 WP_001241357.1.40548 WP_001241357.1.40549 WP_001241357.1.40560 WP_001241357.1.40563 WP_001241357.1.40596 WP_001241357.1.406 WP_001241357.1.40607 WP_001241357.1.40629 WP_001241357.1.40636 WP_001241357.1.40657 WP_001241357.1.40660 WP_001241357.1.40666 WP_001241357.1.40712 WP_001241357.1.40715 WP_001241357.1.40742 WP_001241357.1.40758 WP_001241357.1.40781 WP_001241357.1.40793 WP_001241357.1.40813 WP_001241357.1.40815 WP_001241357.1.40833 WP_001241357.1.40842 WP_001241357.1.40843 WP_001241357.1.40882 WP_001241357.1.40893 WP_001241357.1.40898 WP_001241357.1.40900 WP_001241357.1.40912 WP_001241357.1.40937 WP_001241357.1.40952 WP_001241357.1.40965 WP_001241357.1.4103 WP_001241357.1.41041 WP_001241357.1.41045 WP_001241357.1.41060 WP_001241357.1.41063 WP_001241357.1.41078 WP_001241357.1.41113 WP_001241357.1.41206 WP_001241357.1.4122 WP_001241357.1.4126 WP_001241357.1.41271 WP_001241357.1.41287 WP_001241357.1.41294 WP_001241357.1.41330 WP_001241357.1.41332 WP_001241357.1.41339 WP_001241357.1.41346 WP_001241357.1.41363 WP_001241357.1.41368 WP_001241357.1.41372 WP_001241357.1.41391 WP_001241357.1.41401 WP_001241357.1.41417 WP_001241357.1.41436 WP_001241357.1.41449 WP_001241357.1.41453 WP_001241357.1.41478 WP_001241357.1.41479 WP_001241357.1.41481 WP_001241357.1.41482 WP_001241357.1.41483 WP_001241357.1.41484 WP_001241357.1.41488 WP_001241357.1.41513 WP_001241357.1.41530 WP_001241357.1.41536 WP_001241357.1.41539 WP_001241357.1.41545 WP_001241357.1.41556 WP_001241357.1.4158 WP_001241357.1.41621 WP_001241357.1.41651 WP_001241357.1.41654 WP_001241357.1.41712 WP_001241357.1.4172 WP_001241357.1.41734 WP_001241357.1.41741 WP_001241357.1.41752 WP_001241357.1.41782 WP_001241357.1.41783 WP_001241357.1.41784 WP_001241357.1.41809 WP_001241357.1.41812 WP_001241357.1.41822 WP_001241357.1.41837 WP_001241357.1.41847 WP_001241357.1.41849 WP_001241357.1.41884 WP_001241357.1.41885 WP_001241357.1.4189 WP_001241357.1.41900 WP_001241357.1.41923 WP_001241357.1.4193 WP_001241357.1.41956 WP_001241357.1.41960 WP_001241357.1.41964 WP_001241357.1.41988 WP_001241357.1.41990 WP_001241357.1.41991 WP_001241357.1.42022 WP_001241357.1.42027 WP_001241357.1.42033 WP_001241357.1.42036 WP_001241357.1.42044 WP_001241357.1.42060 WP_001241357.1.42073 WP_001241357.1.42113 WP_001241357.1.4213 WP_001241357.1.42151 WP_001241357.1.42159 WP_001241357.1.42179 WP_001241357.1.42191 WP_001241357.1.42209 WP_001241357.1.42214 WP_001241357.1.42221 WP_001241357.1.42228 WP_001241357.1.42258 WP_001241357.1.42318 WP_001241357.1.42350 WP_001241357.1.42376 WP_001241357.1.42413 WP_001241357.1.4242 WP_001241357.1.42432 WP_001241357.1.42443 WP_001241357.1.42447 WP_001241357.1.42448 WP_001241357.1.42456 WP_001241357.1.42480 WP_001241357.1.4250 WP_001241357.1.42513 WP_001241357.1.42516 WP_001241357.1.42547 WP_001241357.1.42586 WP_001241357.1.42594 WP_001241357.1.42597 WP_001241357.1.42600 WP_001241357.1.42601 WP_001241357.1.4261 WP_001241357.1.42632 WP_001241357.1.42638 WP_001241357.1.42669 WP_001241357.1.42670 WP_001241357.1.42677 WP_001241357.1.42709 WP_001241357.1.42749 WP_001241357.1.42756 WP_001241357.1.42770 WP_001241357.1.42771 WP_001241357.1.42804 WP_001241357.1.42808 WP_001241357.1.4282 WP_001241357.1.42863 WP_001241357.1.42879 WP_001241357.1.42880 WP_001241357.1.42891 WP_001241357.1.4290 WP_001241357.1.42903 WP_001241357.1.42918 WP_001241357.1.42936 WP_001241357.1.42937 WP_001241357.1.42970 WP_001241357.1.42975 WP_001241357.1.42987 WP_001241357.1.42989 WP_001241357.1.42991 WP_001241357.1.43013 WP_001241357.1.43027 WP_001241357.1.4306 WP_001241357.1.43079 WP_001241357.1.43121 WP_001241357.1.43123 WP_001241357.1.4313 WP_001241357.1.43132 WP_001241357.1.43133 WP_001241357.1.43137 WP_001241357.1.43140 WP_001241357.1.43170 WP_001241357.1.43174 WP_001241357.1.43177 WP_001241357.1.43196 WP_001241357.1.43213 WP_001241357.1.43216 WP_001241357.1.43239 WP_001241357.1.43270 WP_001241357.1.43278 WP_001241357.1.4334 WP_001241357.1.43384 WP_001241357.1.43389 WP_001241357.1.43422 WP_001241357.1.43427 WP_001241357.1.4343 WP_001241357.1.43448 WP_001241357.1.43469 WP_001241357.1.43473 WP_001241357.1.43474 WP_001241357.1.43489 WP_001241357.1.43501 WP_001241357.1.43536 WP_001241357.1.4356 WP_001241357.1.43561 WP_001241357.1.43598 WP_001241357.1.436 WP_001241357.1.43604 WP_001241357.1.43622 WP_001241357.1.43642 WP_001241357.1.43720 WP_001241357.1.43733 WP_001241357.1.43738 WP_001241357.1.43750 WP_001241357.1.43754 WP_001241357.1.43798 WP_001241357.1.43803 WP_001241357.1.43804 WP_001241357.1.43816 WP_001241357.1.43837 WP_001241357.1.43868 WP_001241357.1.43898 WP_001241357.1.43911 WP_001241357.1.43918 WP_001241357.1.43925 WP_001241357.1.43939 WP_001241357.1.43942 WP_001241357.1.43953 WP_001241357.1.43966 WP_001241357.1.440 WP_001241357.1.44020 WP_001241357.1.44029 WP_001241357.1.44040 WP_001241357.1.44051 WP_001241357.1.44075 WP_001241357.1.44088 WP_001241357.1.44096 WP_001241357.1.44100 WP_001241357.1.44115 WP_001241357.1.44125 WP_001241357.1.44130 WP_001241357.1.44162 WP_001241357.1.44165 WP_001241357.1.44166 WP_001241357.1.44201 WP_001241357.1.44203 WP_001241357.1.44211 WP_001241357.1.44222 WP_001241357.1.44251 WP_001241357.1.44263 WP_001241357.1.44273 WP_001241357.1.44324 WP_001241357.1.44327 WP_001241357.1.44354 WP_001241357.1.44365 WP_001241357.1.44389 WP_001241357.1.44394 WP_001241357.1.44422 WP_001241357.1.44447 WP_001241357.1.4445 WP_001241357.1.44452 WP_001241357.1.44458 WP_001241357.1.44460 WP_001241357.1.44488 WP_001241357.1.4449 WP_001241357.1.44524 WP_001241357.1.4454 WP_001241357.1.44558 WP_001241357.1.44561 WP_001241357.1.44570 WP_001241357.1.4459 WP_001241357.1.44610 WP_001241357.1.44622 WP_001241357.1.44627 WP_001241357.1.4463 WP_001241357.1.44642 WP_001241357.1.44649 WP_001241357.1.44661 WP_001241357.1.44668 WP_001241357.1.44671 WP_001241357.1.4471 WP_001241357.1.44717 WP_001241357.1.44724 WP_001241357.1.44733 WP_001241357.1.44756 WP_001241357.1.44759 WP_001241357.1.44784 WP_001241357.1.44800 WP_001241357.1.44821 WP_001241357.1.44836 WP_001241357.1.44840 WP_001241357.1.44841 WP_001241357.1.44843 WP_001241357.1.44849 WP_001241357.1.44854 WP_001241357.1.44855 WP_001241357.1.44906 WP_001241357.1.44923 WP_001241357.1.44954 WP_001241357.1.44960 WP_001241357.1.44961 WP_001241357.1.44970 WP_001241357.1.44975 WP_001241357.1.44977 WP_001241357.1.44980 WP_001241357.1.45000 WP_001241357.1.45020 WP_001241357.1.45028 WP_001241357.1.45043 WP_001241357.1.45076 WP_001241357.1.45104 WP_001241357.1.45153 WP_001241357.1.4516 WP_001241357.1.45190 WP_001241357.1.45195 WP_001241357.1.45246 WP_001241357.1.45293 WP_001241357.1.4530 WP_001241357.1.45313 WP_001241357.1.45329 WP_001241357.1.4535 WP_001241357.1.4538 WP_001241357.1.45392 WP_001241357.1.45404 WP_001241357.1.45405 WP_001241357.1.4541 WP_001241357.1.45444 WP_001241357.1.4549 WP_001241357.1.45525 WP_001241357.1.45536 WP_001241357.1.45538 WP_001241357.1.45565 WP_001241357.1.45575 WP_001241357.1.45581 WP_001241357.1.45595 WP_001241357.1.45600 WP_001241357.1.45627 WP_001241357.1.45664 WP_001241357.1.45674 WP_001241357.1.45676 WP_001241357.1.4570 WP_001241357.1.45707 WP_001241357.1.45740 WP_001241357.1.45741 WP_001241357.1.45752 WP_001241357.1.4576 WP_001241357.1.45789 WP_001241357.1.45793 WP_001241357.1.45799 WP_001241357.1.45801 WP_001241357.1.45806 WP_001241357.1.4583 WP_001241357.1.45840 WP_001241357.1.45841 WP_001241357.1.45865 WP_001241357.1.45891 WP_001241357.1.45901 WP_001241357.1.45921 WP_001241357.1.4593 WP_001241357.1.45930 WP_001241357.1.45931 WP_001241357.1.45933 WP_001241357.1.45941 WP_001241357.1.45949 WP_001241357.1.45990 WP_001241357.1.46016 WP_001241357.1.46026 WP_001241357.1.46027 WP_001241357.1.46039 WP_001241357.1.46049 WP_001241357.1.46081 WP_001241357.1.46097 WP_001241357.1.4610 WP_001241357.1.46115 WP_001241357.1.46122 WP_001241357.1.4613 WP_001241357.1.46164 WP_001241357.1.46186 WP_001241357.1.4619 WP_001241357.1.46213 WP_001241357.1.46217 WP_001241357.1.46239 WP_001241357.1.46257 WP_001241357.1.46263 WP_001241357.1.46282 WP_001241357.1.46283 WP_001241357.1.46291 WP_001241357.1.46329 WP_001241357.1.46369 WP_001241357.1.46378 WP_001241357.1.46414 WP_001241357.1.46429 WP_001241357.1.46438 WP_001241357.1.46441 WP_001241357.1.46451 WP_001241357.1.4646 WP_001241357.1.4647 WP_001241357.1.46487 WP_001241357.1.46503 WP_001241357.1.46531 WP_001241357.1.46552 WP_001241357.1.46573 WP_001241357.1.46582 WP_001241357.1.46589 WP_001241357.1.46597 WP_001241357.1.46611 WP_001241357.1.46616 WP_001241357.1.46626 WP_001241357.1.46643 WP_001241357.1.4670 WP_001241357.1.46795 WP_001241357.1.46798 WP_001241357.1.46802 WP_001241357.1.46806 WP_001241357.1.46810 WP_001241357.1.46820 WP_001241357.1.46821 WP_001241357.1.46832 WP_001241357.1.46833 WP_001241357.1.46841 WP_001241357.1.46860 WP_001241357.1.46909 WP_001241357.1.46913 WP_001241357.1.46932 WP_001241357.1.4695 WP_001241357.1.46990 WP_001241357.1.46991 WP_001241357.1.46994 WP_001241357.1.47028 WP_001241357.1.47029 WP_001241357.1.47038 WP_001241357.1.47039 WP_001241357.1.47047 WP_001241357.1.47048 WP_001241357.1.47050 WP_001241357.1.47054 WP_001241357.1.47063 WP_001241357.1.47073 WP_001241357.1.4708 WP_001241357.1.47124 WP_001241357.1.47140 WP_001241357.1.47156 WP_001241357.1.47167 WP_001241357.1.47171 WP_001241357.1.47189 WP_001241357.1.47197 WP_001241357.1.47198 WP_001241357.1.4722 WP_001241357.1.47224 WP_001241357.1.4723 WP_001241357.1.47235 WP_001241357.1.47246 WP_001241357.1.47247 WP_001241357.1.4725 WP_001241357.1.47307 WP_001241357.1.47319 WP_001241357.1.47322 WP_001241357.1.47344 WP_001241357.1.47349 WP_001241357.1.47366 WP_001241357.1.47370 WP_001241357.1.47398 WP_001241357.1.47401 WP_001241357.1.47411 WP_001241357.1.47414 WP_001241357.1.4743 WP_001241357.1.47454 WP_001241357.1.47464 WP_001241357.1.47488 WP_001241357.1.47496 WP_001241357.1.47498 WP_001241357.1.47500 WP_001241357.1.47529 WP_001241357.1.47533 WP_001241357.1.47546 WP_001241357.1.47599 WP_001241357.1.47634 WP_001241357.1.47646 WP_001241357.1.47654 WP_001241357.1.47709 WP_001241357.1.4772 WP_001241357.1.47722 WP_001241357.1.47734 WP_001241357.1.47744 WP_001241357.1.47761 WP_001241357.1.47764 WP_001241357.1.47765 WP_001241357.1.47770 WP_001241357.1.47775 WP_001241357.1.47784 WP_001241357.1.47791 WP_001241357.1.47827 WP_001241357.1.4783 WP_001241357.1.47884 WP_001241357.1.47935 WP_001241357.1.47954 WP_001241357.1.47962 WP_001241357.1.47976 WP_001241357.1.47994 WP_001241357.1.48029 WP_001241357.1.48040 WP_001241357.1.48051 WP_001241357.1.48065 WP_001241357.1.48073 WP_001241357.1.48080 WP_001241357.1.48090 WP_001241357.1.48096 WP_001241357.1.4811 WP_001241357.1.48111 WP_001241357.1.4812 WP_001241357.1.48121 WP_001241357.1.48168 WP_001241357.1.48176 WP_001241357.1.48188 WP_001241357.1.48194 WP_001241357.1.48200 WP_001241357.1.48203 WP_001241357.1.48216 WP_001241357.1.48226 WP_001241357.1.48258 WP_001241357.1.4826 WP_001241357.1.48265 WP_001241357.1.48290 WP_001241357.1.48291 WP_001241357.1.48317 WP_001241357.1.48353 WP_001241357.1.48385 WP_001241357.1.48431 WP_001241357.1.48469 WP_001241357.1.48477 WP_001241357.1.48480 WP_001241357.1.48483 WP_001241357.1.48505 WP_001241357.1.48522 WP_001241357.1.4857 WP_001241357.1.486 WP_001241357.1.48615 WP_001241357.1.48620 WP_001241357.1.48626 WP_001241357.1.48629 WP_001241357.1.48689 WP_001241357.1.48697 WP_001241357.1.4871 WP_001241357.1.48712 WP_001241357.1.4876 WP_001241357.1.48792 WP_001241357.1.48806 WP_001241357.1.48808 WP_001241357.1.48827 WP_001241357.1.48847 WP_001241357.1.48860 WP_001241357.1.48902 WP_001241357.1.48910 WP_001241357.1.4892 WP_001241357.1.48921 WP_001241357.1.48926 WP_001241357.1.48953 WP_001241357.1.48970 WP_001241357.1.48974 WP_001241357.1.49001 WP_001241357.1.49009 WP_001241357.1.49061 WP_001241357.1.49076 WP_001241357.1.49104 WP_001241357.1.49124 WP_001241357.1.49170 WP_001241357.1.49179 WP_001241357.1.49190 WP_001241357.1.49258 WP_001241357.1.49275 WP_001241357.1.4931 WP_001241357.1.49321 WP_001241357.1.49332 WP_001241357.1.49338 WP_001241357.1.49342 WP_001241357.1.49347 WP_001241357.1.49363 WP_001241357.1.49376 WP_001241357.1.49401 WP_001241357.1.49412 WP_001241357.1.49446 WP_001241357.1.49464 WP_001241357.1.49481 WP_001241357.1.49482 WP_001241357.1.49483 WP_001241357.1.4949 WP_001241357.1.49496 WP_001241357.1.49521 WP_001241357.1.49522 WP_001241357.1.4953 WP_001241357.1.49531 WP_001241357.1.49537 WP_001241357.1.49546 WP_001241357.1.49558 WP_001241357.1.49567 WP_001241357.1.49594 WP_001241357.1.49615 WP_001241357.1.49621 WP_001241357.1.49625 WP_001241357.1.49645 WP_001241357.1.49655 WP_001241357.1.49661 WP_001241357.1.49662 WP_001241357.1.49675 WP_001241357.1.49722 WP_001241357.1.49733 WP_001241357.1.49768 WP_001241357.1.49771 WP_001241357.1.49774 WP_001241357.1.49783 WP_001241357.1.49788 WP_001241357.1.49794 WP_001241357.1.49820 WP_001241357.1.49823 WP_001241357.1.4985 WP_001241357.1.49879 WP_001241357.1.49883 WP_001241357.1.49884 WP_001241357.1.49900 WP_001241357.1.49941 WP_001241357.1.49954 WP_001241357.1.49972 WP_001241357.1.50006 WP_001241357.1.50008 WP_001241357.1.5003 WP_001241357.1.50036 WP_001241357.1.50056 WP_001241357.1.50058 WP_001241357.1.50078 WP_001241357.1.50110 WP_001241357.1.50146 WP_001241357.1.5017 WP_001241357.1.50179 WP_001241357.1.50187 WP_001241357.1.50191 WP_001241357.1.50207 WP_001241357.1.50214 WP_001241357.1.50228 WP_001241357.1.50262 WP_001241357.1.50266 WP_001241357.1.50270 WP_001241357.1.50278 WP_001241357.1.50304 WP_001241357.1.50345 WP_001241357.1.50358 WP_001241357.1.50361 WP_001241357.1.5037 WP_001241357.1.50380 WP_001241357.1.50412 WP_001241357.1.50418 WP_001241357.1.50427 WP_001241357.1.50452 WP_001241357.1.5056 WP_001241357.1.50579 WP_001241357.1.50585 WP_001241357.1.50586 WP_001241357.1.50608 WP_001241357.1.50627 WP_001241357.1.5067 WP_001241357.1.50690 WP_001241357.1.50700 WP_001241357.1.50728 WP_001241357.1.50762 WP_001241357.1.50887 WP_001241357.1.50925 WP_001241357.1.50947 WP_001241357.1.5095 WP_001241357.1.50957 WP_001241357.1.50986 WP_001241357.1.50988 WP_001241357.1.50990 WP_001241357.1.51027 WP_001241357.1.51042 WP_001241357.1.51058 WP_001241357.1.5106 WP_001241357.1.511 WP_001241357.1.51109 WP_001241357.1.51154 WP_001241357.1.51170 WP_001241357.1.51171 WP_001241357.1.51172 WP_001241357.1.51180 WP_001241357.1.51190 WP_001241357.1.51203 WP_001241357.1.51206 WP_001241357.1.51211 WP_001241357.1.5124 WP_001241357.1.51248 WP_001241357.1.51253 WP_001241357.1.5128 WP_001241357.1.51283 WP_001241357.1.51300 WP_001241357.1.51307 WP_001241357.1.51330 WP_001241357.1.51360 WP_001241357.1.51380 WP_001241357.1.51392 WP_001241357.1.51405 WP_001241357.1.51425 WP_001241357.1.51426 WP_001241357.1.51427 WP_001241357.1.51430 WP_001241357.1.5146 WP_001241357.1.51495 WP_001241357.1.51505 WP_001241357.1.5153 WP_001241357.1.51548 WP_001241357.1.51552 WP_001241357.1.5158 WP_001241357.1.51587 WP_001241357.1.51596 WP_001241357.1.51600 WP_001241357.1.51607 WP_001241357.1.51643 WP_001241357.1.51690 WP_001241357.1.51693 WP_001241357.1.51707 WP_001241357.1.51718 WP_001241357.1.51736 WP_001241357.1.51757 WP_001241357.1.51760 WP_001241357.1.51784 WP_001241357.1.518 WP_001241357.1.51804 WP_001241357.1.51834 WP_001241357.1.51839 WP_001241357.1.51873 WP_001241357.1.51881 WP_001241357.1.51896 WP_001241357.1.51899 WP_001241357.1.51944 WP_001241357.1.51949 WP_001241357.1.51968 WP_001241357.1.51979 WP_001241357.1.51985 WP_001241357.1.5199 WP_001241357.1.52002 WP_001241357.1.52020 WP_001241357.1.52039 WP_001241357.1.52048 WP_001241357.1.52076 WP_001241357.1.52085 WP_001241357.1.52098 WP_001241357.1.52127 WP_001241357.1.52137 WP_001241357.1.5217 WP_001241357.1.52186 WP_001241357.1.52200 WP_001241357.1.52211 WP_001241357.1.52213 WP_001241357.1.52214 WP_001241357.1.52243 WP_001241357.1.52249 WP_001241357.1.52257 WP_001241357.1.52258 WP_001241357.1.52270 WP_001241357.1.52271 WP_001241357.1.52299 WP_001241357.1.52305 WP_001241357.1.52313 WP_001241357.1.52333 WP_001241357.1.52363 WP_001241357.1.52378 WP_001241357.1.52399 WP_001241357.1.52406 WP_001241357.1.52421 WP_001241357.1.52492 WP_001241357.1.52496 WP_001241357.1.52524 WP_001241357.1.52542 WP_001241357.1.52543 WP_001241357.1.52544 WP_001241357.1.52558 WP_001241357.1.52568 WP_001241357.1.52631 WP_001241357.1.5265 WP_001241357.1.52662 WP_001241357.1.52691 WP_001241357.1.52704 WP_001241357.1.52710 WP_001241357.1.52762 WP_001241357.1.52771 WP_001241357.1.52774 WP_001241357.1.52780 WP_001241357.1.52781 WP_001241357.1.52801 WP_001241357.1.52804 WP_001241357.1.52844 WP_001241357.1.52846 WP_001241357.1.5285 WP_001241357.1.52852 WP_001241357.1.52853 WP_001241357.1.52855 WP_001241357.1.52883 WP_001241357.1.5291 WP_001241357.1.52933 WP_001241357.1.52945 WP_001241357.1.52995 WP_001241357.1.53012 WP_001241357.1.53020 WP_001241357.1.53021 WP_001241357.1.53084 WP_001241357.1.53095 WP_001241357.1.53110 WP_001241357.1.53123 WP_001241357.1.53162 WP_001241357.1.53181 WP_001241357.1.532 WP_001241357.1.53211 WP_001241357.1.5322 WP_001241357.1.53228 WP_001241357.1.53244 WP_001241357.1.53252 WP_001241357.1.53270 WP_001241357.1.53327 WP_001241357.1.53356 WP_001241357.1.53360 WP_001241357.1.53377 WP_001241357.1.53410 WP_001241357.1.53415 WP_001241357.1.5342 WP_001241357.1.53428 WP_001241357.1.53505 WP_001241357.1.53556 WP_001241357.1.53557 WP_001241357.1.53587 WP_001241357.1.53589 WP_001241357.1.53592 WP_001241357.1.53594 WP_001241357.1.5362 WP_001241357.1.53642 WP_001241357.1.53645 WP_001241357.1.53649 WP_001241357.1.53687 WP_001241357.1.53690 WP_001241357.1.53693 WP_001241357.1.53769 WP_001241357.1.53810 WP_001241357.1.53841 WP_001241357.1.53884 WP_001241357.1.5391 WP_001241357.1.5393 WP_001241357.1.53931 WP_001241357.1.53940 WP_001241357.1.53966 WP_001241357.1.53972 WP_001241357.1.53978 WP_001241357.1.53991 WP_001241357.1.53994 WP_001241357.1.54013 WP_001241357.1.54023 WP_001241357.1.54024 WP_001241357.1.54028 WP_001241357.1.54032 WP_001241357.1.54051 WP_001241357.1.54072 WP_001241357.1.54095 WP_001241357.1.54102 WP_001241357.1.54104 WP_001241357.1.54144 WP_001241357.1.54185 WP_001241357.1.54188 WP_001241357.1.54208 WP_001241357.1.54213 WP_001241357.1.54313 WP_001241357.1.54317 WP_001241357.1.54328 WP_001241357.1.54329 WP_001241357.1.5434 WP_001241357.1.54344 WP_001241357.1.54359 WP_001241357.1.54388 WP_001241357.1.54394 WP_001241357.1.5441 WP_001241357.1.54411 WP_001241357.1.54417 WP_001241357.1.54418 WP_001241357.1.54429 WP_001241357.1.54454 WP_001241357.1.54463 WP_001241357.1.54476 WP_001241357.1.54507 WP_001241357.1.54524 WP_001241357.1.54534 WP_001241357.1.54585 WP_001241357.1.54590 WP_001241357.1.5460 WP_001241357.1.54601 WP_001241357.1.54602 WP_001241357.1.54605 WP_001241357.1.5461 WP_001241357.1.54617 WP_001241357.1.54620 WP_001241357.1.54638 WP_001241357.1.54643 WP_001241357.1.5467 WP_001241357.1.54688 WP_001241357.1.5470 WP_001241357.1.54708 WP_001241357.1.54725 WP_001241357.1.54729 WP_001241357.1.54754 WP_001241357.1.54755 WP_001241357.1.54760 WP_001241357.1.54769 WP_001241357.1.5478 WP_001241357.1.5479 WP_001241357.1.54817 WP_001241357.1.54875 WP_001241357.1.54883 WP_001241357.1.54927 WP_001241357.1.54940 WP_001241357.1.54941 WP_001241357.1.54972 WP_001241357.1.54981 WP_001241357.1.54989 WP_001241357.1.54991 WP_001241357.1.54993 WP_001241357.1.55003 WP_001241357.1.55005 WP_001241357.1.55041 WP_001241357.1.55070 WP_001241357.1.55112 WP_001241357.1.5512 WP_001241357.1.55134 WP_001241357.1.55144 WP_001241357.1.55149 WP_001241357.1.55151 WP_001241357.1.55179 WP_001241357.1.55185 WP_001241357.1.55203 WP_001241357.1.55222 WP_001241357.1.55226 WP_001241357.1.55273 WP_001241357.1.55275 WP_001241357.1.55286 WP_001241357.1.55291 WP_001241357.1.55359 WP_001241357.1.55374 WP_001241357.1.55417 WP_001241357.1.55420 WP_001241357.1.55424 WP_001241357.1.55425 WP_001241357.1.5546 WP_001241357.1.55466 WP_001241357.1.55472 WP_001241357.1.55489 WP_001241357.1.55492 WP_001241357.1.55507 WP_001241357.1.55529 WP_001241357.1.55550 WP_001241357.1.55551 WP_001241357.1.55560 WP_001241357.1.55563 WP_001241357.1.55571 WP_001241357.1.55574 WP_001241357.1.55608 WP_001241357.1.5561 WP_001241357.1.55629 WP_001241357.1.55676 WP_001241357.1.5570 WP_001241357.1.55720 WP_001241357.1.55731 WP_001241357.1.55744 WP_001241357.1.55757 WP_001241357.1.55787 WP_001241357.1.55790 WP_001241357.1.55791 WP_001241357.1.55808 WP_001241357.1.55820 WP_001241357.1.55825 WP_001241357.1.55838 WP_001241357.1.55868 WP_001241357.1.55870 WP_001241357.1.55888 WP_001241357.1.55892 WP_001241357.1.55896 WP_001241357.1.55897 WP_001241357.1.55936 WP_001241357.1.55981 WP_001241357.1.55990 WP_001241357.1.56033 WP_001241357.1.56040 WP_001241357.1.56047 WP_001241357.1.56072 WP_001241357.1.561 WP_001241357.1.56122 WP_001241357.1.56139 WP_001241357.1.5614 WP_001241357.1.56142 WP_001241357.1.56149 WP_001241357.1.56151 WP_001241357.1.56164 WP_001241357.1.56169 WP_001241357.1.56197 WP_001241357.1.562 WP_001241357.1.56216 WP_001241357.1.56231 WP_001241357.1.56278 WP_001241357.1.56285 WP_001241357.1.56293 WP_001241357.1.5632 WP_001241357.1.56338 WP_001241357.1.56358 WP_001241357.1.56371 WP_001241357.1.5639 WP_001241357.1.56392 WP_001241357.1.56399 WP_001241357.1.56402 WP_001241357.1.56439 WP_001241357.1.56457 WP_001241357.1.56469 WP_001241357.1.56481 WP_001241357.1.56489 WP_001241357.1.56491 WP_001241357.1.56501 WP_001241357.1.56502 WP_001241357.1.56523 WP_001241357.1.56528 WP_001241357.1.56554 WP_001241357.1.56571 WP_001241357.1.56586 WP_001241357.1.56650 WP_001241357.1.56662 WP_001241357.1.56665 WP_001241357.1.56689 WP_001241357.1.56704 WP_001241357.1.56714 WP_001241357.1.56721 WP_001241357.1.56742 WP_001241357.1.56786 WP_001241357.1.56789 WP_001241357.1.56799 WP_001241357.1.56821 WP_001241357.1.56830 WP_001241357.1.56846 WP_001241357.1.56871 WP_001241357.1.56882 WP_001241357.1.56933 WP_001241357.1.56936 WP_001241357.1.56941 WP_001241357.1.56978 WP_001241357.1.56980 WP_001241357.1.57011 WP_001241357.1.57032 WP_001241357.1.57045 WP_001241357.1.57051 WP_001241357.1.57068 WP_001241357.1.57071 WP_001241357.1.57079 WP_001241357.1.57124 WP_001241357.1.57150 WP_001241357.1.57159 WP_001241357.1.57180 WP_001241357.1.57181 WP_001241357.1.57182 WP_001241357.1.57197 WP_001241357.1.57202 WP_001241357.1.57213 WP_001241357.1.57216 WP_001241357.1.57222 WP_001241357.1.57266 WP_001241357.1.57278 WP_001241357.1.57280 WP_001241357.1.57348 WP_001241357.1.57349 WP_001241357.1.57386 WP_001241357.1.57395 WP_001241357.1.57401 WP_001241357.1.57403 WP_001241357.1.57410 WP_001241357.1.57414 WP_001241357.1.5742 WP_001241357.1.57432 WP_001241357.1.57438 WP_001241357.1.57451 WP_001241357.1.57453 WP_001241357.1.57466 WP_001241357.1.5748 WP_001241357.1.57492 WP_001241357.1.57517 WP_001241357.1.57538 WP_001241357.1.57539 WP_001241357.1.57550 WP_001241357.1.57558 WP_001241357.1.57608 WP_001241357.1.57610 WP_001241357.1.57638 WP_001241357.1.5764 WP_001241357.1.57646 WP_001241357.1.57659 WP_001241357.1.57719 WP_001241357.1.57832 WP_001241357.1.57836 WP_001241357.1.57846 WP_001241357.1.57851 WP_001241357.1.57854 WP_001241357.1.5786 WP_001241357.1.5787 WP_001241357.1.57920 WP_001241357.1.57982 WP_001241357.1.57983 WP_001241357.1.57994 WP_001241357.1.58009 WP_001241357.1.58038 WP_001241357.1.58048 WP_001241357.1.58057 WP_001241357.1.58060 WP_001241357.1.58092 WP_001241357.1.58094 WP_001241357.1.58097 WP_001241357.1.58098 WP_001241357.1.5810 WP_001241357.1.58107 WP_001241357.1.58136 WP_001241357.1.58146 WP_001241357.1.58163 WP_001241357.1.58169 WP_001241357.1.58206 WP_001241357.1.58232 WP_001241357.1.58233 WP_001241357.1.58238 WP_001241357.1.58244 WP_001241357.1.58248 WP_001241357.1.58267 WP_001241357.1.58289 WP_001241357.1.58292 WP_001241357.1.58316 WP_001241357.1.58336 WP_001241357.1.58340 WP_001241357.1.58345 WP_001241357.1.58371 WP_001241357.1.58384 WP_001241357.1.584 WP_001241357.1.58401 WP_001241357.1.58408 WP_001241357.1.58414 WP_001241357.1.58423 WP_001241357.1.58424 WP_001241357.1.58429 WP_001241357.1.58440 WP_001241357.1.58444 WP_001241357.1.58449 WP_001241357.1.58459 WP_001241357.1.58493 WP_001241357.1.585 WP_001241357.1.58507 WP_001241357.1.5852 WP_001241357.1.58547 WP_001241357.1.58552 WP_001241357.1.58560 WP_001241357.1.58572 WP_001241357.1.58609 WP_001241357.1.58617 WP_001241357.1.58657 WP_001241357.1.58692 WP_001241357.1.58707 WP_001241357.1.58723 WP_001241357.1.58737 WP_001241357.1.58799 WP_001241357.1.58837 WP_001241357.1.58867 WP_001241357.1.58870 WP_001241357.1.58901 WP_001241357.1.58940 WP_001241357.1.58951 WP_001241357.1.58958 WP_001241357.1.58976 WP_001241357.1.58999 WP_001241357.1.59024 WP_001241357.1.59026 WP_001241357.1.59038 WP_001241357.1.59047 WP_001241357.1.59055 WP_001241357.1.5906 WP_001241357.1.59060 WP_001241357.1.59073 WP_001241357.1.59165 WP_001241357.1.59199 WP_001241357.1.59226 WP_001241357.1.59263 WP_001241357.1.5927 WP_001241357.1.59291 WP_001241357.1.59292 WP_001241357.1.59306 WP_001241357.1.59374 WP_001241357.1.59395 WP_001241357.1.59407 WP_001241357.1.59409 WP_001241357.1.5942 WP_001241357.1.59423 WP_001241357.1.59425 WP_001241357.1.59426 WP_001241357.1.59470 WP_001241357.1.59483 WP_001241357.1.59491 WP_001241357.1.59513 WP_001241357.1.59533 WP_001241357.1.59553 WP_001241357.1.59572 WP_001241357.1.59577 WP_001241357.1.59579 WP_001241357.1.59590 WP_001241357.1.59611 WP_001241357.1.59613 WP_001241357.1.59615 WP_001241357.1.59621 WP_001241357.1.5963 WP_001241357.1.59638 WP_001241357.1.5965 WP_001241357.1.59660 WP_001241357.1.59679 WP_001241357.1.59714 WP_001241357.1.59717 WP_001241357.1.59730 WP_001241357.1.59733 WP_001241357.1.59737 WP_001241357.1.59745 WP_001241357.1.59748 WP_001241357.1.59756 WP_001241357.1.59781 WP_001241357.1.59788 WP_001241357.1.59793 WP_001241357.1.59815 WP_001241357.1.59823 WP_001241357.1.59838 WP_001241357.1.59853 WP_001241357.1.59858 WP_001241357.1.59877 WP_001241357.1.59894 WP_001241357.1.59900 WP_001241357.1.59905 WP_001241357.1.59912 WP_001241357.1.59931 WP_001241357.1.59959 WP_001241357.1.59970 WP_001241357.1.59980 WP_001241357.1.59981 WP_001241357.1.59989 WP_001241357.1.59998 WP_001241357.1.6002 WP_001241357.1.60023 WP_001241357.1.60031 WP_001241357.1.60042 WP_001241357.1.60043 WP_001241357.1.60048 WP_001241357.1.60067 WP_001241357.1.60096 WP_001241357.1.60110 WP_001241357.1.60117 WP_001241357.1.6013 WP_001241357.1.60133 WP_001241357.1.60151 WP_001241357.1.60225 WP_001241357.1.60228 WP_001241357.1.60235 WP_001241357.1.60304 WP_001241357.1.60325 WP_001241357.1.60337 WP_001241357.1.60342 WP_001241357.1.60343 WP_001241357.1.60350 WP_001241357.1.60373 WP_001241357.1.60374 WP_001241357.1.60411 WP_001241357.1.60453 WP_001241357.1.60461 WP_001241357.1.60498 WP_001241357.1.60505 WP_001241357.1.60544 WP_001241357.1.60550 WP_001241357.1.60555 WP_001241357.1.60567 WP_001241357.1.60591 WP_001241357.1.6061 WP_001241357.1.60613 WP_001241357.1.60630 WP_001241357.1.60647 WP_001241357.1.60654 WP_001241357.1.6066 WP_001241357.1.6068 WP_001241357.1.60698 WP_001241357.1.60717 WP_001241357.1.60744 WP_001241357.1.60761 WP_001241357.1.60764 WP_001241357.1.60805 WP_001241357.1.60872 WP_001241357.1.60895 WP_001241357.1.60901 WP_001241357.1.60927 WP_001241357.1.60935 WP_001241357.1.61005 WP_001241357.1.61006 WP_001241357.1.61039 WP_001241357.1.61046 WP_001241357.1.6106 WP_001241357.1.61096 WP_001241357.1.61097 WP_001241357.1.61099 WP_001241357.1.61102 WP_001241357.1.61108 WP_001241357.1.61121 WP_001241357.1.61132 WP_001241357.1.61170 WP_001241357.1.61175 WP_001241357.1.61181 WP_001241357.1.61186 WP_001241357.1.61241 WP_001241357.1.61245 WP_001241357.1.61253 WP_001241357.1.61284 WP_001241357.1.613 WP_001241357.1.61360 WP_001241357.1.61364 WP_001241357.1.6138 WP_001241357.1.61398 WP_001241357.1.61442 WP_001241357.1.61445 WP_001241357.1.61480 WP_001241357.1.615 WP_001241357.1.61505 WP_001241357.1.61512 WP_001241357.1.61517 WP_001241357.1.61551 WP_001241357.1.61608 WP_001241357.1.61617 WP_001241357.1.61623 WP_001241357.1.61636 WP_001241357.1.61663 WP_001241357.1.61739 WP_001241357.1.61770 WP_001241357.1.61772 WP_001241357.1.61779 WP_001241357.1.61789 WP_001241357.1.618 WP_001241357.1.61806 WP_001241357.1.61822 WP_001241357.1.61835 WP_001241357.1.61858 WP_001241357.1.61874 WP_001241357.1.61949 WP_001241357.1.61985 WP_001241357.1.62038 WP_001241357.1.62043 WP_001241357.1.62091 WP_001241357.1.62099 WP_001241357.1.62102 WP_001241357.1.6212 WP_001241357.1.62135 WP_001241357.1.62157 WP_001241357.1.62182 WP_001241357.1.62207 WP_001241357.1.62236 WP_001241357.1.62262 WP_001241357.1.62264 WP_001241357.1.62266 WP_001241357.1.62282 WP_001241357.1.62296 WP_001241357.1.62322 WP_001241357.1.62337 WP_001241357.1.62358 WP_001241357.1.62424 WP_001241357.1.62454 WP_001241357.1.62460 WP_001241357.1.62480 WP_001241357.1.62481 WP_001241357.1.62503 WP_001241357.1.62555 WP_001241357.1.62586 WP_001241357.1.6261 WP_001241357.1.62612 WP_001241357.1.62631 WP_001241357.1.62642 WP_001241357.1.62668 WP_001241357.1.62675 WP_001241357.1.62714 WP_001241357.1.62735 WP_001241357.1.62750 WP_001241357.1.62762 WP_001241357.1.62769 WP_001241357.1.62780 WP_001241357.1.62784 WP_001241357.1.62787 WP_001241357.1.62788 WP_001241357.1.62812 WP_001241357.1.62819 WP_001241357.1.6282 WP_001241357.1.62840 WP_001241357.1.62843 WP_001241357.1.62866 WP_001241357.1.62885 WP_001241357.1.62888 WP_001241357.1.62914 WP_001241357.1.62919 WP_001241357.1.6293 WP_001241357.1.62951 WP_001241357.1.62973 WP_001241357.1.62989 WP_001241357.1.6307 WP_001241357.1.63078 WP_001241357.1.63113 WP_001241357.1.63167 WP_001241357.1.63177 WP_001241357.1.63189 WP_001241357.1.6323 WP_001241357.1.63246 WP_001241357.1.63271 WP_001241357.1.63285 WP_001241357.1.63287 WP_001241357.1.63305 WP_001241357.1.6331 WP_001241357.1.63310 WP_001241357.1.63330 WP_001241357.1.63350 WP_001241357.1.6337 WP_001241357.1.63370 WP_001241357.1.63374 WP_001241357.1.63393 WP_001241357.1.63419 WP_001241357.1.63433 WP_001241357.1.63445 WP_001241357.1.63453 WP_001241357.1.63465 WP_001241357.1.63466 WP_001241357.1.63470 WP_001241357.1.63478 WP_001241357.1.6348 WP_001241357.1.63484 WP_001241357.1.63487 WP_001241357.1.63496 WP_001241357.1.63536 WP_001241357.1.63554 WP_001241357.1.63556 WP_001241357.1.63563 WP_001241357.1.63586 WP_001241357.1.63604 WP_001241357.1.63608 WP_001241357.1.63612 WP_001241357.1.63615 WP_001241357.1.6364 WP_001241357.1.63703 WP_001241357.1.63721 WP_001241357.1.63746 WP_001241357.1.63810 WP_001241357.1.63814 WP_001241357.1.63872 WP_001241357.1.63944 WP_001241357.1.63957 WP_001241357.1.63964 WP_001241357.1.63969 WP_001241357.1.64008 WP_001241357.1.64030 WP_001241357.1.64040 WP_001241357.1.64045 WP_001241357.1.64053 WP_001241357.1.64080 WP_001241357.1.64086 WP_001241357.1.64110 WP_001241357.1.64138 WP_001241357.1.64150 WP_001241357.1.64153 WP_001241357.1.6416 WP_001241357.1.64161 WP_001241357.1.64165 WP_001241357.1.64175 WP_001241357.1.64180 WP_001241357.1.64190 WP_001241357.1.64193 WP_001241357.1.64285 WP_001241357.1.64286 WP_001241357.1.643 WP_001241357.1.6431 WP_001241357.1.64312 WP_001241357.1.64321 WP_001241357.1.64330 WP_001241357.1.64337 WP_001241357.1.64355 WP_001241357.1.64371 WP_001241357.1.64380 WP_001241357.1.64391 WP_001241357.1.64417 WP_001241357.1.6444 WP_001241357.1.64448 WP_001241357.1.6445 WP_001241357.1.64458 WP_001241357.1.6446 WP_001241357.1.64520 WP_001241357.1.64547 WP_001241357.1.64621 WP_001241357.1.64670 WP_001241357.1.64693 WP_001241357.1.64695 WP_001241357.1.64712 WP_001241357.1.64746 WP_001241357.1.64749 WP_001241357.1.64784 WP_001241357.1.64789 WP_001241357.1.64793 WP_001241357.1.64840 WP_001241357.1.64875 WP_001241357.1.64901 WP_001241357.1.64912 WP_001241357.1.64926 WP_001241357.1.64930 WP_001241357.1.64946 WP_001241357.1.64970 WP_001241357.1.6499 WP_001241357.1.64990 WP_001241357.1.6500 WP_001241357.1.65035 WP_001241357.1.65040 WP_001241357.1.65056 WP_001241357.1.65061 WP_001241357.1.65084 WP_001241357.1.65097 WP_001241357.1.651 WP_001241357.1.65104 WP_001241357.1.6511 WP_001241357.1.65114 WP_001241357.1.65116 WP_001241357.1.65118 WP_001241357.1.65122 WP_001241357.1.65151 WP_001241357.1.65155 WP_001241357.1.65194 WP_001241357.1.65206 WP_001241357.1.65240 WP_001241357.1.65256 WP_001241357.1.6527 WP_001241357.1.65271 WP_001241357.1.65286 WP_001241357.1.65305 WP_001241357.1.65353 WP_001241357.1.65355 WP_001241357.1.65364 WP_001241357.1.65366 WP_001241357.1.6537 WP_001241357.1.65370 WP_001241357.1.65372 WP_001241357.1.654 WP_001241357.1.65405 WP_001241357.1.65408 WP_001241357.1.65413 WP_001241357.1.65415 WP_001241357.1.65484 WP_001241357.1.65493 WP_001241357.1.65531 WP_001241357.1.65546 WP_001241357.1.65565 WP_001241357.1.65571 WP_001241357.1.65581 WP_001241357.1.65596 WP_001241357.1.65606 WP_001241357.1.6563 WP_001241357.1.65662 WP_001241357.1.65672 WP_001241357.1.65708 WP_001241357.1.65749 WP_001241357.1.6576 WP_001241357.1.65762 WP_001241357.1.65834 WP_001241357.1.6587 WP_001241357.1.65875 WP_001241357.1.65898 WP_001241357.1.65912 WP_001241357.1.65957 WP_001241357.1.65961 WP_001241357.1.65963 WP_001241357.1.65976 WP_001241357.1.65978 WP_001241357.1.65988 WP_001241357.1.65991 WP_001241357.1.66016 WP_001241357.1.66017 WP_001241357.1.66022 WP_001241357.1.66033 WP_001241357.1.6604 WP_001241357.1.66044 WP_001241357.1.66050 WP_001241357.1.66059 WP_001241357.1.66071 WP_001241357.1.66100 WP_001241357.1.66104 WP_001241357.1.66105 WP_001241357.1.66127 WP_001241357.1.66161 WP_001241357.1.6618 WP_001241357.1.66197 WP_001241357.1.66255 WP_001241357.1.66280 WP_001241357.1.66290 WP_001241357.1.66295 WP_001241357.1.66327 WP_001241357.1.6635 WP_001241357.1.66376 WP_001241357.1.66387 WP_001241357.1.66389 WP_001241357.1.66392 WP_001241357.1.66395 WP_001241357.1.66412 WP_001241357.1.66421 WP_001241357.1.66448 WP_001241357.1.66501 WP_001241357.1.66511 WP_001241357.1.66523 WP_001241357.1.66531 WP_001241357.1.6654 WP_001241357.1.66550 WP_001241357.1.66566 WP_001241357.1.66579 WP_001241357.1.66644 WP_001241357.1.6665 WP_001241357.1.6666 WP_001241357.1.66667 WP_001241357.1.66668 WP_001241357.1.66700 WP_001241357.1.66706 WP_001241357.1.66708 WP_001241357.1.66719 WP_001241357.1.66727 WP_001241357.1.66751 WP_001241357.1.66758 WP_001241357.1.6676 WP_001241357.1.66783 WP_001241357.1.66787 WP_001241357.1.66794 WP_001241357.1.66795 WP_001241357.1.66796 WP_001241357.1.66849 WP_001241357.1.66873 WP_001241357.1.66922 WP_001241357.1.66933 WP_001241357.1.66948 WP_001241357.1.66978 WP_001241357.1.6698 WP_001241357.1.66984 WP_001241357.1.6701 WP_001241357.1.67022 WP_001241357.1.67026 WP_001241357.1.67029 WP_001241357.1.67035 WP_001241357.1.67047 WP_001241357.1.67055 WP_001241357.1.6706 WP_001241357.1.67073 WP_001241357.1.67116 WP_001241357.1.67120 WP_001241357.1.67132 WP_001241357.1.67136 WP_001241357.1.67137 WP_001241357.1.67150 WP_001241357.1.67153 WP_001241357.1.67158 WP_001241357.1.67164 WP_001241357.1.67174 WP_001241357.1.67200 WP_001241357.1.67209 WP_001241357.1.67210 WP_001241357.1.67214 WP_001241357.1.67258 WP_001241357.1.67272 WP_001241357.1.67278 WP_001241357.1.67284 WP_001241357.1.67293 WP_001241357.1.67373 WP_001241357.1.67383 WP_001241357.1.67412 WP_001241357.1.67415 WP_001241357.1.67427 WP_001241357.1.67446 WP_001241357.1.67451 WP_001241357.1.67454 WP_001241357.1.67456 WP_001241357.1.67464 WP_001241357.1.67468 WP_001241357.1.67495 WP_001241357.1.67533 WP_001241357.1.67538 WP_001241357.1.67549 WP_001241357.1.67553 WP_001241357.1.67590 WP_001241357.1.67606 WP_001241357.1.67669 WP_001241357.1.67676 WP_001241357.1.67681 WP_001241357.1.67685 WP_001241357.1.6769 WP_001241357.1.67690 WP_001241357.1.67726 WP_001241357.1.67732 WP_001241357.1.67737 WP_001241357.1.67753 WP_001241357.1.67758 WP_001241357.1.67760 WP_001241357.1.67775 WP_001241357.1.67780 WP_001241357.1.67786 WP_001241357.1.67787 WP_001241357.1.67788 WP_001241357.1.678 WP_001241357.1.67802 WP_001241357.1.67853 WP_001241357.1.67891 WP_001241357.1.67894 WP_001241357.1.6793 WP_001241357.1.67971 WP_001241357.1.67975 WP_001241357.1.67990 WP_001241357.1.67992 WP_001241357.1.68008 WP_001241357.1.68012 WP_001241357.1.6802 WP_001241357.1.68025 WP_001241357.1.6803 WP_001241357.1.68039 WP_001241357.1.68052 WP_001241357.1.68058 WP_001241357.1.68059 WP_001241357.1.68063 WP_001241357.1.68067 WP_001241357.1.68070 WP_001241357.1.68071 WP_001241357.1.68079 WP_001241357.1.68096 WP_001241357.1.6810 WP_001241357.1.68138 WP_001241357.1.6814 WP_001241357.1.68157 WP_001241357.1.68170 WP_001241357.1.68177 WP_001241357.1.68200 WP_001241357.1.68215 WP_001241357.1.68231 WP_001241357.1.68241 WP_001241357.1.68255 WP_001241357.1.68271 WP_001241357.1.68279 WP_001241357.1.68283 WP_001241357.1.68292 WP_001241357.1.68336 WP_001241357.1.68341 WP_001241357.1.68362 WP_001241357.1.68372 WP_001241357.1.68411 WP_001241357.1.68441 WP_001241357.1.68493 WP_001241357.1.68523 WP_001241357.1.68524 WP_001241357.1.68534 WP_001241357.1.68566 WP_001241357.1.68572 WP_001241357.1.6859 WP_001241357.1.68632 WP_001241357.1.68673 WP_001241357.1.68697 WP_001241357.1.68701 WP_001241357.1.68711 WP_001241357.1.68731 WP_001241357.1.68735 WP_001241357.1.68750 WP_001241357.1.68751 WP_001241357.1.6877 WP_001241357.1.68793 WP_001241357.1.68795 WP_001241357.1.68797 WP_001241357.1.6880 WP_001241357.1.68838 WP_001241357.1.68847 WP_001241357.1.68865 WP_001241357.1.6887 WP_001241357.1.68873 WP_001241357.1.68877 WP_001241357.1.68911 WP_001241357.1.68924 WP_001241357.1.68936 WP_001241357.1.68942 WP_001241357.1.68952 WP_001241357.1.6897 WP_001241357.1.68989 WP_001241357.1.68995 WP_001241357.1.69033 WP_001241357.1.69054 WP_001241357.1.69127 WP_001241357.1.69144 WP_001241357.1.69158 WP_001241357.1.6916 WP_001241357.1.69160 WP_001241357.1.6921 WP_001241357.1.69221 WP_001241357.1.6923 WP_001241357.1.69258 WP_001241357.1.69261 WP_001241357.1.69303 WP_001241357.1.69305 WP_001241357.1.69327 WP_001241357.1.69341 WP_001241357.1.69350 WP_001241357.1.69351 WP_001241357.1.69382 WP_001241357.1.69404 WP_001241357.1.69438 WP_001241357.1.6945 WP_001241357.1.69450 WP_001241357.1.69473 WP_001241357.1.69502 WP_001241357.1.69506 WP_001241357.1.69569 WP_001241357.1.69583 WP_001241357.1.69593 WP_001241357.1.69605 WP_001241357.1.69643 WP_001241357.1.69646 WP_001241357.1.69649 WP_001241357.1.69655 WP_001241357.1.69689 WP_001241357.1.697 WP_001241357.1.69716 WP_001241357.1.69735 WP_001241357.1.69780 WP_001241357.1.69786 WP_001241357.1.69803 WP_001241357.1.69810 WP_001241357.1.69818 WP_001241357.1.69831 WP_001241357.1.69832 WP_001241357.1.69868 WP_001241357.1.69872 WP_001241357.1.69887 WP_001241357.1.69896 WP_001241357.1.69963 WP_001241357.1.69972 WP_001241357.1.69999 WP_001241357.1.7001 WP_001241357.1.70041 WP_001241357.1.70063 WP_001241357.1.701 WP_001241357.1.70123 WP_001241357.1.70125 WP_001241357.1.7013 WP_001241357.1.70149 WP_001241357.1.7015 WP_001241357.1.70191 WP_001241357.1.70200 WP_001241357.1.70230 WP_001241357.1.70251 WP_001241357.1.70300 WP_001241357.1.70337 WP_001241357.1.70341 WP_001241357.1.70370 WP_001241357.1.70386 WP_001241357.1.70407 WP_001241357.1.70408 WP_001241357.1.70414 WP_001241357.1.70477 WP_001241357.1.70492 WP_001241357.1.7050 WP_001241357.1.70517 WP_001241357.1.70539 WP_001241357.1.70563 WP_001241357.1.70576 WP_001241357.1.70578 WP_001241357.1.70582 WP_001241357.1.70597 WP_001241357.1.70619 WP_001241357.1.70655 WP_001241357.1.70686 WP_001241357.1.70705 WP_001241357.1.70713 WP_001241357.1.70723 WP_001241357.1.70745 WP_001241357.1.70767 WP_001241357.1.70787 WP_001241357.1.70794 WP_001241357.1.70880 WP_001241357.1.70896 WP_001241357.1.7090 WP_001241357.1.70900 WP_001241357.1.71003 WP_001241357.1.7102 WP_001241357.1.71024 WP_001241357.1.71042 WP_001241357.1.71099 WP_001241357.1.71139 WP_001241357.1.71149 WP_001241357.1.71158 WP_001241357.1.71159 WP_001241357.1.71162 WP_001241357.1.71183 WP_001241357.1.71192 WP_001241357.1.71199 WP_001241357.1.71205 WP_001241357.1.7121 WP_001241357.1.71221 WP_001241357.1.71225 WP_001241357.1.71226 WP_001241357.1.71229 WP_001241357.1.71269 WP_001241357.1.71272 WP_001241357.1.71285 WP_001241357.1.71287 WP_001241357.1.71294 WP_001241357.1.71311 WP_001241357.1.71312 WP_001241357.1.71315 WP_001241357.1.71323 WP_001241357.1.71327 WP_001241357.1.71397 WP_001241357.1.71403 WP_001241357.1.71405 WP_001241357.1.71409 WP_001241357.1.71421 WP_001241357.1.71423 WP_001241357.1.71448 WP_001241357.1.71480 WP_001241357.1.71533 WP_001241357.1.71537 WP_001241357.1.71538 WP_001241357.1.71562 WP_001241357.1.71563 WP_001241357.1.71603 WP_001241357.1.71607 WP_001241357.1.71632 WP_001241357.1.71680 WP_001241357.1.71690 WP_001241357.1.71695 WP_001241357.1.71712 WP_001241357.1.71724 WP_001241357.1.71732 WP_001241357.1.71767 WP_001241357.1.71783 WP_001241357.1.71830 WP_001241357.1.71837 WP_001241357.1.71840 WP_001241357.1.71855 WP_001241357.1.71856 WP_001241357.1.71912 WP_001241357.1.71938 WP_001241357.1.71939 WP_001241357.1.71940 WP_001241357.1.71944 WP_001241357.1.71967 WP_001241357.1.71972 WP_001241357.1.71975 WP_001241357.1.71987 WP_001241357.1.71993 WP_001241357.1.71995 WP_001241357.1.72016 WP_001241357.1.72028 WP_001241357.1.72033 WP_001241357.1.72048 WP_001241357.1.7205 WP_001241357.1.72053 WP_001241357.1.72066 WP_001241357.1.72098 WP_001241357.1.7210 WP_001241357.1.72117 WP_001241357.1.72125 WP_001241357.1.72141 WP_001241357.1.72157 WP_001241357.1.72161 WP_001241357.1.72162 WP_001241357.1.72180 WP_001241357.1.72184 WP_001241357.1.72186 WP_001241357.1.72208 WP_001241357.1.72212 WP_001241357.1.72237 WP_001241357.1.72240 WP_001241357.1.72248 WP_001241357.1.72258 WP_001241357.1.72261 WP_001241357.1.72279 WP_001241357.1.72290 WP_001241357.1.72298 WP_001241357.1.723 WP_001241357.1.72316 WP_001241357.1.72322 WP_001241357.1.72337 WP_001241357.1.72342 WP_001241357.1.72352 WP_001241357.1.72359 WP_001241357.1.72388 WP_001241357.1.72397 WP_001241357.1.72425 WP_001241357.1.72427 WP_001241357.1.72431 WP_001241357.1.72436 WP_001241357.1.72449 WP_001241357.1.72469 WP_001241357.1.72485 WP_001241357.1.72507 WP_001241357.1.72511 WP_001241357.1.72535 WP_001241357.1.72537 WP_001241357.1.72544 WP_001241357.1.72551 WP_001241357.1.72582 WP_001241357.1.72588 WP_001241357.1.72596 WP_001241357.1.72599 WP_001241357.1.72606 WP_001241357.1.72614 WP_001241357.1.72616 WP_001241357.1.72619 WP_001241357.1.72641 WP_001241357.1.72652 WP_001241357.1.72663 WP_001241357.1.72694 WP_001241357.1.72698 WP_001241357.1.72700 WP_001241357.1.72706 WP_001241357.1.72745 WP_001241357.1.72747 WP_001241357.1.72748 WP_001241357.1.72758 WP_001241357.1.7281 WP_001241357.1.72857 WP_001241357.1.72860 WP_001241357.1.72869 WP_001241357.1.72893 WP_001241357.1.7291 WP_001241357.1.72910 WP_001241357.1.72913 WP_001241357.1.72947 WP_001241357.1.72950 WP_001241357.1.72962 WP_001241357.1.73000 WP_001241357.1.73010 WP_001241357.1.73039 WP_001241357.1.73061 WP_001241357.1.7307 WP_001241357.1.73085 WP_001241357.1.7309 WP_001241357.1.73094 WP_001241357.1.73126 WP_001241357.1.73129 WP_001241357.1.73197 WP_001241357.1.73215 WP_001241357.1.73217 WP_001241357.1.73230 WP_001241357.1.73239 WP_001241357.1.73243 WP_001241357.1.73277 WP_001241357.1.73283 WP_001241357.1.73291 WP_001241357.1.73292 WP_001241357.1.73295 WP_001241357.1.73333 WP_001241357.1.73340 WP_001241357.1.73343 WP_001241357.1.73344 WP_001241357.1.73385 WP_001241357.1.73428 WP_001241357.1.73430 WP_001241357.1.7345 WP_001241357.1.73468 WP_001241357.1.73486 WP_001241357.1.7349 WP_001241357.1.73524 WP_001241357.1.73565 WP_001241357.1.73572 WP_001241357.1.73604 WP_001241357.1.73626 WP_001241357.1.73700 WP_001241357.1.73717 WP_001241357.1.73748 WP_001241357.1.73783 WP_001241357.1.73785 WP_001241357.1.73801 WP_001241357.1.73827 WP_001241357.1.73835 WP_001241357.1.73843 WP_001241357.1.73844 WP_001241357.1.73859 WP_001241357.1.73882 WP_001241357.1.73908 WP_001241357.1.7392 WP_001241357.1.73934 WP_001241357.1.73942 WP_001241357.1.73968 WP_001241357.1.73992 WP_001241357.1.73995 WP_001241357.1.74032 WP_001241357.1.74041 WP_001241357.1.74046 WP_001241357.1.7407 WP_001241357.1.7411 WP_001241357.1.74184 WP_001241357.1.74185 WP_001241357.1.7424 WP_001241357.1.74251 WP_001241357.1.74267 WP_001241357.1.7429 WP_001241357.1.74309 WP_001241357.1.74358 WP_001241357.1.74365 WP_001241357.1.74367 WP_001241357.1.744 WP_001241357.1.74426 WP_001241357.1.74444 WP_001241357.1.74445 WP_001241357.1.7446 WP_001241357.1.74478 WP_001241357.1.74491 WP_001241357.1.74509 WP_001241357.1.74513 WP_001241357.1.74520 WP_001241357.1.74521 WP_001241357.1.74528 WP_001241357.1.74536 WP_001241357.1.74549 WP_001241357.1.74557 WP_001241357.1.74574 WP_001241357.1.7461 WP_001241357.1.74611 WP_001241357.1.74623 WP_001241357.1.74625 WP_001241357.1.74631 WP_001241357.1.74652 WP_001241357.1.74682 WP_001241357.1.74688 WP_001241357.1.74691 WP_001241357.1.74705 WP_001241357.1.74713 WP_001241357.1.74720 WP_001241357.1.74735 WP_001241357.1.7475 WP_001241357.1.74765 WP_001241357.1.74767 WP_001241357.1.74828 WP_001241357.1.74844 WP_001241357.1.74854 WP_001241357.1.74860 WP_001241357.1.74880 WP_001241357.1.74895 WP_001241357.1.74904 WP_001241357.1.74915 WP_001241357.1.74962 WP_001241357.1.74998 WP_001241357.1.75021 WP_001241357.1.75030 WP_001241357.1.75050 WP_001241357.1.75087 WP_001241357.1.75100 WP_001241357.1.75112 WP_001241357.1.75118 WP_001241357.1.75124 WP_001241357.1.75139 WP_001241357.1.75145 WP_001241357.1.75149 WP_001241357.1.7516 WP_001241357.1.75164 WP_001241357.1.75218 WP_001241357.1.75228 WP_001241357.1.75243 WP_001241357.1.75248 WP_001241357.1.75254 WP_001241357.1.75306 WP_001241357.1.7536 WP_001241357.1.75360 WP_001241357.1.75367 WP_001241357.1.75382 WP_001241357.1.7539 WP_001241357.1.75419 WP_001241357.1.75491 WP_001241357.1.75505 WP_001241357.1.75507 WP_001241357.1.75536 WP_001241357.1.75537 WP_001241357.1.75557 WP_001241357.1.75577 WP_001241357.1.75594 WP_001241357.1.75612 WP_001241357.1.75629 WP_001241357.1.75644 WP_001241357.1.75679 WP_001241357.1.75687 WP_001241357.1.75694 WP_001241357.1.75696 WP_001241357.1.75699 WP_001241357.1.75725 WP_001241357.1.75735 WP_001241357.1.75758 WP_001241357.1.75767 WP_001241357.1.75786 WP_001241357.1.75808 WP_001241357.1.7583 WP_001241357.1.75839 WP_001241357.1.75853 WP_001241357.1.75892 WP_001241357.1.75918 WP_001241357.1.75922 WP_001241357.1.7597 WP_001241357.1.75983 WP_001241357.1.75989 WP_001241357.1.75995 WP_001241357.1.76005 WP_001241357.1.76019 WP_001241357.1.7603 WP_001241357.1.76030 WP_001241357.1.76036 WP_001241357.1.76039 WP_001241357.1.76054 WP_001241357.1.76057 WP_001241357.1.7608 WP_001241357.1.76103 WP_001241357.1.76119 WP_001241357.1.76129 WP_001241357.1.7613 WP_001241357.1.76152 WP_001241357.1.7617 WP_001241357.1.76189 WP_001241357.1.76194 WP_001241357.1.76196 WP_001241357.1.76237 WP_001241357.1.76268 WP_001241357.1.76269 WP_001241357.1.76305 WP_001241357.1.76312 WP_001241357.1.76325 WP_001241357.1.76335 WP_001241357.1.76361 WP_001241357.1.76376 WP_001241357.1.76387 WP_001241357.1.76407 WP_001241357.1.76446 WP_001241357.1.76447 WP_001241357.1.76448 WP_001241357.1.76460 WP_001241357.1.76462 WP_001241357.1.76469 WP_001241357.1.76477 WP_001241357.1.76504 WP_001241357.1.76562 WP_001241357.1.76596 WP_001241357.1.7661 WP_001241357.1.76619 WP_001241357.1.76643 WP_001241357.1.76656 WP_001241357.1.76660 WP_001241357.1.76697 WP_001241357.1.76701 WP_001241357.1.76751 WP_001241357.1.76759 WP_001241357.1.7680 WP_001241357.1.76815 WP_001241357.1.76827 WP_001241357.1.76831 WP_001241357.1.76863 WP_001241357.1.7689 WP_001241357.1.76909 WP_001241357.1.76918 WP_001241357.1.76933 WP_001241357.1.76948 WP_001241357.1.76957 WP_001241357.1.76961 WP_001241357.1.7699 WP_001241357.1.76994 WP_001241357.1.77007 WP_001241357.1.77036 WP_001241357.1.77042 WP_001241357.1.77057 WP_001241357.1.77081 WP_001241357.1.77099 WP_001241357.1.771 WP_001241357.1.77128 WP_001241357.1.77134 WP_001241357.1.77147 WP_001241357.1.77162 WP_001241357.1.77163 WP_001241357.1.77173 WP_001241357.1.77175 WP_001241357.1.77198 WP_001241357.1.77200 WP_001241357.1.77204 WP_001241357.1.77214 WP_001241357.1.77224 WP_001241357.1.77239 WP_001241357.1.77253 WP_001241357.1.77275 WP_001241357.1.7728 WP_001241357.1.77284 WP_001241357.1.7729 WP_001241357.1.77290 WP_001241357.1.77291 WP_001241357.1.77296 WP_001241357.1.7731 WP_001241357.1.77320 WP_001241357.1.77326 WP_001241357.1.77358 WP_001241357.1.77392 WP_001241357.1.77408 WP_001241357.1.77419 WP_001241357.1.77432 WP_001241357.1.77452 WP_001241357.1.77455 WP_001241357.1.77462 WP_001241357.1.7747 WP_001241357.1.77470 WP_001241357.1.77481 WP_001241357.1.77487 WP_001241357.1.77495 WP_001241357.1.7750 WP_001241357.1.77503 WP_001241357.1.77511 WP_001241357.1.77551 WP_001241357.1.7756 WP_001241357.1.77577 WP_001241357.1.77595 WP_001241357.1.77632 WP_001241357.1.77636 WP_001241357.1.77643 WP_001241357.1.77644 WP_001241357.1.77648 WP_001241357.1.77657 WP_001241357.1.77707 WP_001241357.1.7775 WP_001241357.1.77760 WP_001241357.1.77767 WP_001241357.1.77768 WP_001241357.1.7780 WP_001241357.1.77813 WP_001241357.1.77816 WP_001241357.1.77833 WP_001241357.1.77876 WP_001241357.1.77949 WP_001241357.1.77950 WP_001241357.1.77961 WP_001241357.1.77979 WP_001241357.1.7799 WP_001241357.1.78000 WP_001241357.1.78007 WP_001241357.1.78010 WP_001241357.1.7804 WP_001241357.1.78041 WP_001241357.1.78063 WP_001241357.1.7808 WP_001241357.1.78089 WP_001241357.1.78101 WP_001241357.1.78102 WP_001241357.1.78131 WP_001241357.1.78183 WP_001241357.1.78187 WP_001241357.1.78188 WP_001241357.1.78196 WP_001241357.1.78202 WP_001241357.1.78232 WP_001241357.1.78233 WP_001241357.1.78235 WP_001241357.1.78297 WP_001241357.1.78305 WP_001241357.1.78321 WP_001241357.1.78323 WP_001241357.1.78368 WP_001241357.1.78376 WP_001241357.1.78377 WP_001241357.1.784 WP_001241357.1.78413 WP_001241357.1.78445 WP_001241357.1.78453 WP_001241357.1.78462 WP_001241357.1.78463 WP_001241357.1.7847 WP_001241357.1.78477 WP_001241357.1.78491 WP_001241357.1.78512 WP_001241357.1.78527 WP_001241357.1.7855 WP_001241357.1.78572 WP_001241357.1.78575 WP_001241357.1.78581 WP_001241357.1.78583 WP_001241357.1.78586 WP_001241357.1.78593 WP_001241357.1.78610 WP_001241357.1.78611 WP_001241357.1.78612 WP_001241357.1.78622 WP_001241357.1.78645 WP_001241357.1.78677 WP_001241357.1.78683 WP_001241357.1.78687 WP_001241357.1.78689 WP_001241357.1.78706 WP_001241357.1.78714 WP_001241357.1.78718 WP_001241357.1.78750 WP_001241357.1.78773 WP_001241357.1.78791 WP_001241357.1.78814 WP_001241357.1.7883 WP_001241357.1.78845 WP_001241357.1.78888 WP_001241357.1.78891 WP_001241357.1.78893 WP_001241357.1.78895 WP_001241357.1.78908 WP_001241357.1.78919 WP_001241357.1.78953 WP_001241357.1.78955 WP_001241357.1.78956 WP_001241357.1.7896 WP_001241357.1.78996 WP_001241357.1.79001 WP_001241357.1.79004 WP_001241357.1.79065 WP_001241357.1.79067 WP_001241357.1.79086 WP_001241357.1.79100 WP_001241357.1.79126 WP_001241357.1.79137 WP_001241357.1.79159 WP_001241357.1.79172 WP_001241357.1.79233 WP_001241357.1.79243 WP_001241357.1.79246 WP_001241357.1.79248 WP_001241357.1.79249 WP_001241357.1.79276 WP_001241357.1.79306 WP_001241357.1.79312 WP_001241357.1.79342 WP_001241357.1.79343 WP_001241357.1.79346 WP_001241357.1.79348 WP_001241357.1.79356 WP_001241357.1.79365 WP_001241357.1.79368 WP_001241357.1.79369 WP_001241357.1.7937 WP_001241357.1.79389 WP_001241357.1.7940 WP_001241357.1.79409 WP_001241357.1.79414 WP_001241357.1.79443 WP_001241357.1.79464 WP_001241357.1.79478 WP_001241357.1.79505 WP_001241357.1.7952 WP_001241357.1.79525 WP_001241357.1.79528 WP_001241357.1.79558 WP_001241357.1.79563 WP_001241357.1.79576 WP_001241357.1.79619 WP_001241357.1.79640 WP_001241357.1.7967 WP_001241357.1.79685 WP_001241357.1.79707 WP_001241357.1.79715 WP_001241357.1.79749 WP_001241357.1.79759 WP_001241357.1.79764 WP_001241357.1.79816 WP_001241357.1.79840 WP_001241357.1.7985 WP_001241357.1.79866 WP_001241357.1.7987 WP_001241357.1.79871 WP_001241357.1.79877 WP_001241357.1.79905 WP_001241357.1.79922 WP_001241357.1.7993 WP_001241357.1.79931 WP_001241357.1.79932 WP_001241357.1.79933 WP_001241357.1.79952 WP_001241357.1.79955 WP_001241357.1.79965 WP_001241357.1.79973 WP_001241357.1.79984 WP_001241357.1.79995 WP_001241357.1.80 WP_001241357.1.80016 WP_001241357.1.80026 WP_001241357.1.80043 WP_001241357.1.80060 WP_001241357.1.80061 WP_001241357.1.80063 WP_001241357.1.80071 WP_001241357.1.80096 WP_001241357.1.80106 WP_001241357.1.8011 WP_001241357.1.80136 WP_001241357.1.80168 WP_001241357.1.80176 WP_001241357.1.80179 WP_001241357.1.80183 WP_001241357.1.80255 WP_001241357.1.80309 WP_001241357.1.80320 WP_001241357.1.80330 WP_001241357.1.80343 WP_001241357.1.80392 WP_001241357.1.804 WP_001241357.1.80402 WP_001241357.1.80428 WP_001241357.1.80440 WP_001241357.1.80463 WP_001241357.1.80484 WP_001241357.1.80517 WP_001241357.1.80519 WP_001241357.1.80524 WP_001241357.1.80558 WP_001241357.1.80559 WP_001241357.1.8057 WP_001241357.1.80577 WP_001241357.1.80578 WP_001241357.1.80606 WP_001241357.1.80626 WP_001241357.1.80660 WP_001241357.1.80662 WP_001241357.1.80666 WP_001241357.1.8068 WP_001241357.1.80718 WP_001241357.1.80724 WP_001241357.1.80737 WP_001241357.1.80753 WP_001241357.1.80754 WP_001241357.1.80756 WP_001241357.1.8076 WP_001241357.1.80768 WP_001241357.1.80789 WP_001241357.1.80804 WP_001241357.1.80805 WP_001241357.1.80862 WP_001241357.1.80884 WP_001241357.1.80894 WP_001241357.1.8090 WP_001241357.1.80935 WP_001241357.1.80948 WP_001241357.1.80966 WP_001241357.1.81026 WP_001241357.1.81032 WP_001241357.1.81034 WP_001241357.1.81036 WP_001241357.1.81054 WP_001241357.1.81056 WP_001241357.1.81070 WP_001241357.1.81098 WP_001241357.1.81104 WP_001241357.1.81120 WP_001241357.1.81141 WP_001241357.1.81156 WP_001241357.1.81160 WP_001241357.1.8118 WP_001241357.1.81186 WP_001241357.1.8121 WP_001241357.1.81219 WP_001241357.1.81266 WP_001241357.1.81267 WP_001241357.1.81273 WP_001241357.1.81283 WP_001241357.1.81286 WP_001241357.1.8129 WP_001241357.1.81313 WP_001241357.1.81323 WP_001241357.1.81347 WP_001241357.1.81396 WP_001241357.1.814 WP_001241357.1.81418 WP_001241357.1.81420 WP_001241357.1.81423 WP_001241357.1.81442 WP_001241357.1.81469 WP_001241357.1.81484 WP_001241357.1.81514 WP_001241357.1.81576 WP_001241357.1.81577 WP_001241357.1.81580 WP_001241357.1.81582 WP_001241357.1.81588 WP_001241357.1.81589 WP_001241357.1.81618 WP_001241357.1.81624 WP_001241357.1.81715 WP_001241357.1.8172 WP_001241357.1.81739 WP_001241357.1.81754 WP_001241357.1.81761 WP_001241357.1.81806 WP_001241357.1.81821 WP_001241357.1.8183 WP_001241357.1.81832 WP_001241357.1.81843 WP_001241357.1.81873 WP_001241357.1.81876 WP_001241357.1.81888 WP_001241357.1.81934 WP_001241357.1.81935 WP_001241357.1.81939 WP_001241357.1.81956 WP_001241357.1.81972 WP_001241357.1.81975 WP_001241357.1.82008 WP_001241357.1.82010 WP_001241357.1.82057 WP_001241357.1.82074 WP_001241357.1.82104 WP_001241357.1.82106 WP_001241357.1.82123 WP_001241357.1.82137 WP_001241357.1.82166 WP_001241357.1.82221 WP_001241357.1.82275 WP_001241357.1.82296 WP_001241357.1.82316 WP_001241357.1.8235 WP_001241357.1.82378 WP_001241357.1.82485 WP_001241357.1.82507 WP_001241357.1.82514 WP_001241357.1.82527 WP_001241357.1.82539 WP_001241357.1.8255 WP_001241357.1.82589 WP_001241357.1.82594 WP_001241357.1.82626 WP_001241357.1.82629 WP_001241357.1.82647 WP_001241357.1.82661 WP_001241357.1.8268 WP_001241357.1.82682 WP_001241357.1.82691 WP_001241357.1.82698 WP_001241357.1.82700 WP_001241357.1.82711 WP_001241357.1.82715 WP_001241357.1.82718 WP_001241357.1.82747 WP_001241357.1.82754 WP_001241357.1.8277 WP_001241357.1.82776 WP_001241357.1.82784 WP_001241357.1.82797 WP_001241357.1.82808 WP_001241357.1.82816 WP_001241357.1.82820 WP_001241357.1.82831 WP_001241357.1.82833 WP_001241357.1.82901 WP_001241357.1.82902 WP_001241357.1.82923 WP_001241357.1.8295 WP_001241357.1.82991 WP_001241357.1.83020 WP_001241357.1.83036 WP_001241357.1.83059 WP_001241357.1.8308 WP_001241357.1.83093 WP_001241357.1.83097 WP_001241357.1.83099 WP_001241357.1.83118 WP_001241357.1.83125 WP_001241357.1.83127 WP_001241357.1.83140 WP_001241357.1.83144 WP_001241357.1.83151 WP_001241357.1.83214 WP_001241357.1.83218 WP_001241357.1.83224 WP_001241357.1.83238 WP_001241357.1.83253 WP_001241357.1.83256 WP_001241357.1.83286 WP_001241357.1.83313 WP_001241357.1.83321 WP_001241357.1.83340 WP_001241357.1.83347 WP_001241357.1.83375 WP_001241357.1.83384 WP_001241357.1.83393 WP_001241357.1.83415 WP_001241357.1.8345 WP_001241357.1.83481 WP_001241357.1.83506 WP_001241357.1.83537 WP_001241357.1.83544 WP_001241357.1.83582 WP_001241357.1.83584 WP_001241357.1.83644 WP_001241357.1.83660 WP_001241357.1.83668 WP_001241357.1.8368 WP_001241357.1.83706 WP_001241357.1.83712 WP_001241357.1.83735 WP_001241357.1.83781 WP_001241357.1.83807 WP_001241357.1.83820 WP_001241357.1.8384 WP_001241357.1.8386 WP_001241357.1.83911 WP_001241357.1.83936 WP_001241357.1.83941 WP_001241357.1.83947 WP_001241357.1.84014 WP_001241357.1.84021 WP_001241357.1.8405 WP_001241357.1.84059 WP_001241357.1.8408 WP_001241357.1.8411 WP_001241357.1.84164 WP_001241357.1.84185 WP_001241357.1.84197 WP_001241357.1.84210 WP_001241357.1.84215 WP_001241357.1.84219 WP_001241357.1.84221 WP_001241357.1.84264 WP_001241357.1.84298 WP_001241357.1.84312 WP_001241357.1.84316 WP_001241357.1.84319 WP_001241357.1.84326 WP_001241357.1.84331 WP_001241357.1.84348 WP_001241357.1.84402 WP_001241357.1.84405 WP_001241357.1.84410 WP_001241357.1.84436 WP_001241357.1.8444 WP_001241357.1.84464 WP_001241357.1.8447 WP_001241357.1.84473 WP_001241357.1.84476 WP_001241357.1.84482 WP_001241357.1.84486 WP_001241357.1.84531 WP_001241357.1.84534 WP_001241357.1.84584 WP_001241357.1.84635 WP_001241357.1.84639 WP_001241357.1.84657 WP_001241357.1.84697 WP_001241357.1.84731 WP_001241357.1.84738 WP_001241357.1.84740 WP_001241357.1.8477 WP_001241357.1.84797 WP_001241357.1.84841 WP_001241357.1.84875 WP_001241357.1.84877 WP_001241357.1.84929 WP_001241357.1.84948 WP_001241357.1.84966 WP_001241357.1.84977 WP_001241357.1.84986 WP_001241357.1.84989 WP_001241357.1.84994 WP_001241357.1.85002 WP_001241357.1.85008 WP_001241357.1.85011 WP_001241357.1.85025 WP_001241357.1.85048 WP_001241357.1.85052 WP_001241357.1.85077 WP_001241357.1.85085 WP_001241357.1.85090 WP_001241357.1.85098 WP_001241357.1.85106 WP_001241357.1.85125 WP_001241357.1.85138 WP_001241357.1.8517 WP_001241357.1.85188 WP_001241357.1.85216 WP_001241357.1.85241 WP_001241357.1.85247 WP_001241357.1.85252 WP_001241357.1.85253 WP_001241357.1.85255 WP_001241357.1.85260 WP_001241357.1.8530 WP_001241357.1.85310 WP_001241357.1.85315 WP_001241357.1.85320 WP_001241357.1.85329 WP_001241357.1.85335 WP_001241357.1.85336 WP_001241357.1.85342 WP_001241357.1.85361 WP_001241357.1.85384 WP_001241357.1.85416 WP_001241357.1.85435 WP_001241357.1.85500 WP_001241357.1.85504 WP_001241357.1.85525 WP_001241357.1.85554 WP_001241357.1.85556 WP_001241357.1.85558 WP_001241357.1.85578 WP_001241357.1.85593 WP_001241357.1.85621 WP_001241357.1.85623 WP_001241357.1.8564 WP_001241357.1.85722 WP_001241357.1.85752 WP_001241357.1.85772 WP_001241357.1.85781 WP_001241357.1.8579 WP_001241357.1.85806 WP_001241357.1.8592 WP_001241357.1.85939 WP_001241357.1.85948 WP_001241357.1.85969 WP_001241357.1.86001 WP_001241357.1.86016 WP_001241357.1.86104 WP_001241357.1.86105 WP_001241357.1.86110 WP_001241357.1.86115 WP_001241357.1.86161 WP_001241357.1.86166 WP_001241357.1.86171 WP_001241357.1.86176 WP_001241357.1.86179 WP_001241357.1.86181 WP_001241357.1.86196 WP_001241357.1.8621 WP_001241357.1.86210 WP_001241357.1.86225 WP_001241357.1.86227 WP_001241357.1.86234 WP_001241357.1.86255 WP_001241357.1.86261 WP_001241357.1.86263 WP_001241357.1.86273 WP_001241357.1.86276 WP_001241357.1.86294 WP_001241357.1.86340 WP_001241357.1.86353 WP_001241357.1.86364 WP_001241357.1.86376 WP_001241357.1.86393 WP_001241357.1.86411 WP_001241357.1.86412 WP_001241357.1.86437 WP_001241357.1.86452 WP_001241357.1.86454 WP_001241357.1.86461 WP_001241357.1.86475 WP_001241357.1.86483 WP_001241357.1.86492 WP_001241357.1.8652 WP_001241357.1.8656 WP_001241357.1.86560 WP_001241357.1.86574 WP_001241357.1.86586 WP_001241357.1.86598 WP_001241357.1.86609 WP_001241357.1.86613 WP_001241357.1.86627 WP_001241357.1.86673 WP_001241357.1.86674 WP_001241357.1.86681 WP_001241357.1.86691 WP_001241357.1.86707 WP_001241357.1.86717 WP_001241357.1.86727 WP_001241357.1.86731 WP_001241357.1.86734 WP_001241357.1.86753 WP_001241357.1.86787 WP_001241357.1.86788 WP_001241357.1.8679 WP_001241357.1.86848 WP_001241357.1.86956 WP_001241357.1.86959 WP_001241357.1.86994 WP_001241357.1.86997 WP_001241357.1.87043 WP_001241357.1.8705 WP_001241357.1.87067 WP_001241357.1.87074 WP_001241357.1.87076 WP_001241357.1.87102 WP_001241357.1.8711 WP_001241357.1.87147 WP_001241357.1.87199 WP_001241357.1.87205 WP_001241357.1.87247 WP_001241357.1.87254 WP_001241357.1.87310 WP_001241357.1.87371 WP_001241357.1.87382 WP_001241357.1.87389 WP_001241357.1.87443 WP_001241357.1.87491 WP_001241357.1.87504 WP_001241357.1.87563 WP_001241357.1.87574 WP_001241357.1.87581 WP_001241357.1.87590 WP_001241357.1.87607 WP_001241357.1.87610 WP_001241357.1.87616 WP_001241357.1.87633 WP_001241357.1.87635 WP_001241357.1.87639 WP_001241357.1.87655 WP_001241357.1.87675 WP_001241357.1.87694 WP_001241357.1.87696 WP_001241357.1.87726 WP_001241357.1.87738 WP_001241357.1.87766 WP_001241357.1.8778 WP_001241357.1.87822 WP_001241357.1.87834 WP_001241357.1.87857 WP_001241357.1.87883 WP_001241357.1.87914 WP_001241357.1.87919 WP_001241357.1.87973 WP_001241357.1.87976 WP_001241357.1.87989 WP_001241357.1.87990 WP_001241357.1.88017 WP_001241357.1.8807 WP_001241357.1.88082 WP_001241357.1.88088 WP_001241357.1.88119 WP_001241357.1.88147 WP_001241357.1.88197 WP_001241357.1.8822 WP_001241357.1.88234 WP_001241357.1.88238 WP_001241357.1.88252 WP_001241357.1.88260 WP_001241357.1.88263 WP_001241357.1.88301 WP_001241357.1.88304 WP_001241357.1.88336 WP_001241357.1.88384 WP_001241357.1.88427 WP_001241357.1.8843 WP_001241357.1.88434 WP_001241357.1.88467 WP_001241357.1.8848 WP_001241357.1.88505 WP_001241357.1.88524 WP_001241357.1.88527 WP_001241357.1.88528 WP_001241357.1.88539 WP_001241357.1.8855 WP_001241357.1.88557 WP_001241357.1.88562 WP_001241357.1.88598 WP_001241357.1.88603 WP_001241357.1.88607 WP_001241357.1.88646 WP_001241357.1.88667 WP_001241357.1.88686 WP_001241357.1.88711 WP_001241357.1.88717 WP_001241357.1.88729 WP_001241357.1.8873 WP_001241357.1.88732 WP_001241357.1.88735 WP_001241357.1.88752 WP_001241357.1.88757 WP_001241357.1.88759 WP_001241357.1.88767 WP_001241357.1.8879 WP_001241357.1.88793 WP_001241357.1.88803 WP_001241357.1.88826 WP_001241357.1.88834 WP_001241357.1.88880 WP_001241357.1.88891 WP_001241357.1.88941 WP_001241357.1.88953 WP_001241357.1.88961 WP_001241357.1.88997 WP_001241357.1.89043 WP_001241357.1.89050 WP_001241357.1.89069 WP_001241357.1.89090 WP_001241357.1.89099 WP_001241357.1.89150 WP_001241357.1.89163 WP_001241357.1.89165 WP_001241357.1.89183 WP_001241357.1.89203 WP_001241357.1.89214 WP_001241357.1.89217 WP_001241357.1.89255 WP_001241357.1.8928 WP_001241357.1.89285 WP_001241357.1.89305 WP_001241357.1.89312 WP_001241357.1.89322 WP_001241357.1.89334 WP_001241357.1.89335 WP_001241357.1.89351 WP_001241357.1.89379 WP_001241357.1.8938 WP_001241357.1.89385 WP_001241357.1.89396 WP_001241357.1.894 WP_001241357.1.89405 WP_001241357.1.89416 WP_001241357.1.89427 WP_001241357.1.89455 WP_001241357.1.89458 WP_001241357.1.89466 WP_001241357.1.89468 WP_001241357.1.89469 WP_001241357.1.89471 WP_001241357.1.89474 WP_001241357.1.89551 WP_001241357.1.89569 WP_001241357.1.89583 WP_001241357.1.89601 WP_001241357.1.89627 WP_001241357.1.89630 WP_001241357.1.89631 WP_001241357.1.89646 WP_001241357.1.89674 WP_001241357.1.89679 WP_001241357.1.89700 WP_001241357.1.89747 WP_001241357.1.89781 WP_001241357.1.89788 WP_001241357.1.8985 WP_001241357.1.89852 WP_001241357.1.89879 WP_001241357.1.89895 WP_001241357.1.89899 WP_001241357.1.89915 WP_001241357.1.89917 WP_001241357.1.89918 WP_001241357.1.89923 WP_001241357.1.89927 WP_001241357.1.89959 WP_001241357.1.89977 WP_001241357.1.89988 WP_001241357.1.89998 WP_001241357.1.90017 WP_001241357.1.90022 WP_001241357.1.90050 WP_001241357.1.90065 WP_001241357.1.90078 WP_001241357.1.9009 WP_001241357.1.9010 WP_001241357.1.90128 WP_001241357.1.90139 WP_001241357.1.90146 WP_001241357.1.90156 WP_001241357.1.90168 WP_001241357.1.90171 WP_001241357.1.902 WP_001241357.1.90205 WP_001241357.1.90219 WP_001241357.1.90256 WP_001241357.1.90257 WP_001241357.1.90266 WP_001241357.1.90270 WP_001241357.1.90314 WP_001241357.1.90332 WP_001241357.1.90342 WP_001241357.1.90346 WP_001241357.1.90349 WP_001241357.1.90357 WP_001241357.1.90358 WP_001241357.1.9036 WP_001241357.1.9037 WP_001241357.1.90405 WP_001241357.1.90435 WP_001241357.1.90449 WP_001241357.1.90467 WP_001241357.1.90511 WP_001241357.1.90520 WP_001241357.1.90525 WP_001241357.1.90536 WP_001241357.1.90542 WP_001241357.1.90602 WP_001241357.1.90690 WP_001241357.1.90775 WP_001241357.1.9081 WP_001241357.1.90813 WP_001241357.1.90828 WP_001241357.1.90837 WP_001241357.1.90839 WP_001241357.1.90842 WP_001241357.1.90844 WP_001241357.1.90848 WP_001241357.1.9087 WP_001241357.1.909 WP_001241357.1.90905 WP_001241357.1.90924 WP_001241357.1.90951 WP_001241357.1.90960 WP_001241357.1.90967 WP_001241357.1.90979 WP_001241357.1.9098 WP_001241357.1.90988 WP_001241357.1.90996 WP_001241357.1.90997 WP_001241357.1.91 WP_001241357.1.91007 WP_001241357.1.91010 WP_001241357.1.91018 WP_001241357.1.9104 WP_001241357.1.91072 WP_001241357.1.91088 WP_001241357.1.91094 WP_001241357.1.91121 WP_001241357.1.91143 WP_001241357.1.91153 WP_001241357.1.91170 WP_001241357.1.91182 WP_001241357.1.9119 WP_001241357.1.91213 WP_001241357.1.91220 WP_001241357.1.91268 WP_001241357.1.91277 WP_001241357.1.91288 WP_001241357.1.91290 WP_001241357.1.91340 WP_001241357.1.91341 WP_001241357.1.91354 WP_001241357.1.91356 WP_001241357.1.91361 WP_001241357.1.91384 WP_001241357.1.91397 WP_001241357.1.91414 WP_001241357.1.91425 WP_001241357.1.91445 WP_001241357.1.91462 WP_001241357.1.91482 WP_001241357.1.915 WP_001241357.1.91515 WP_001241357.1.91516 WP_001241357.1.91543 WP_001241357.1.91548 WP_001241357.1.91549 WP_001241357.1.91551 WP_001241357.1.91566 WP_001241357.1.9160 WP_001241357.1.91626 WP_001241357.1.91640 WP_001241357.1.91643 WP_001241357.1.91644 WP_001241357.1.91651 WP_001241357.1.91666 WP_001241357.1.91672 WP_001241357.1.9168 WP_001241357.1.9169 WP_001241357.1.91739 WP_001241357.1.91756 WP_001241357.1.91777 WP_001241357.1.91801 WP_001241357.1.91814 WP_001241357.1.91843 WP_001241357.1.9185 WP_001241357.1.91850 WP_001241357.1.91863 WP_001241357.1.91871 WP_001241357.1.91879 WP_001241357.1.91887 WP_001241357.1.91893 WP_001241357.1.91951 WP_001241357.1.91954 WP_001241357.1.91965 WP_001241357.1.9199 WP_001241357.1.92014 WP_001241357.1.92019 WP_001241357.1.92025 WP_001241357.1.92053 WP_001241357.1.92058 WP_001241357.1.9209 WP_001241357.1.92096 WP_001241357.1.92114 WP_001241357.1.92123 WP_001241357.1.9215 WP_001241357.1.92161 WP_001241357.1.92163 WP_001241357.1.92201 WP_001241357.1.92215 WP_001241357.1.92276 WP_001241357.1.92295 WP_001241357.1.92304 WP_001241357.1.92305 WP_001241357.1.92323 WP_001241357.1.92361 WP_001241357.1.92384 WP_001241357.1.92403 WP_001241357.1.92473 WP_001241357.1.92496 WP_001241357.1.92532 WP_001241357.1.92568 WP_001241357.1.92577 WP_001241357.1.92614 WP_001241357.1.92615 WP_001241357.1.92634 WP_001241357.1.92638 WP_001241357.1.9264 WP_001241357.1.92648 WP_001241357.1.92668 WP_001241357.1.92693 WP_001241357.1.92708 WP_001241357.1.92742 WP_001241357.1.92750 WP_001241357.1.92767 WP_001241357.1.92792 WP_001241357.1.92819 WP_001241357.1.92845 WP_001241357.1.92865 WP_001241357.1.92882 WP_001241357.1.92886 WP_001241357.1.92943 WP_001241357.1.92953 WP_001241357.1.92989 WP_001241357.1.93016 WP_001241357.1.93017 WP_001241357.1.93019 WP_001241357.1.93023 WP_001241357.1.93027 WP_001241357.1.93048 WP_001241357.1.93052 WP_001241357.1.93054 WP_001241357.1.93069 WP_001241357.1.93112 WP_001241357.1.93138 WP_001241357.1.93139 WP_001241357.1.93150 WP_001241357.1.93167 WP_001241357.1.93175 WP_001241357.1.93185 WP_001241357.1.93233 WP_001241357.1.9327 WP_001241357.1.93276 WP_001241357.1.93291 WP_001241357.1.9331 WP_001241357.1.93312 WP_001241357.1.93326 WP_001241357.1.93379 WP_001241357.1.93388 WP_001241357.1.934 WP_001241357.1.93427 WP_001241357.1.93428 WP_001241357.1.93431 WP_001241357.1.93453 WP_001241357.1.93461 WP_001241357.1.93464 WP_001241357.1.93531 WP_001241357.1.93533 WP_001241357.1.93552 WP_001241357.1.9356 WP_001241357.1.93601 WP_001241357.1.93605 WP_001241357.1.93621 WP_001241357.1.93626 WP_001241357.1.93629 WP_001241357.1.93630 WP_001241357.1.93637 WP_001241357.1.93639 WP_001241357.1.93652 WP_001241357.1.93665 WP_001241357.1.93670 WP_001241357.1.93673 WP_001241357.1.93679 WP_001241357.1.93694 WP_001241357.1.93695 WP_001241357.1.93716 WP_001241357.1.93733 WP_001241357.1.93737 WP_001241357.1.93745 WP_001241357.1.93755 WP_001241357.1.93765 WP_001241357.1.93768 WP_001241357.1.93800 WP_001241357.1.93821 WP_001241357.1.93870 WP_001241357.1.93911 WP_001241357.1.93922 WP_001241357.1.93939 WP_001241357.1.93952 WP_001241357.1.93971 WP_001241357.1.94011 WP_001241357.1.94025 WP_001241357.1.94028 WP_001241357.1.94040 WP_001241357.1.94057 WP_001241357.1.94069 WP_001241357.1.94156 WP_001241357.1.9416 WP_001241357.1.94176 WP_001241357.1.94187 WP_001241357.1.94190 WP_001241357.1.9420 WP_001241357.1.94213 WP_001241357.1.9426 WP_001241357.1.94271 WP_001241357.1.94282 WP_001241357.1.94302 WP_001241357.1.94343 WP_001241357.1.94367 WP_001241357.1.94388 WP_001241357.1.94404 WP_001241357.1.94417 WP_001241357.1.94430 WP_001241357.1.94436 WP_001241357.1.94438 WP_001241357.1.94445 WP_001241357.1.94446 WP_001241357.1.94475 WP_001241357.1.94542 WP_001241357.1.94544 WP_001241357.1.94548 WP_001241357.1.9457 WP_001241357.1.94578 WP_001241357.1.94580 WP_001241357.1.94589 WP_001241357.1.94619 WP_001241357.1.94626 WP_001241357.1.94646 WP_001241357.1.94653 WP_001241357.1.94676 WP_001241357.1.94686 WP_001241357.1.94695 WP_001241357.1.94704 WP_001241357.1.94738 WP_001241357.1.94739 WP_001241357.1.9474 WP_001241357.1.94754 WP_001241357.1.94764 WP_001241357.1.94790 WP_001241357.1.948 WP_001241357.1.94806 WP_001241357.1.94808 WP_001241357.1.94823 WP_001241357.1.94836 WP_001241357.1.94841 WP_001241357.1.94847 WP_001241357.1.94869 WP_001241357.1.94880 WP_001241357.1.9489 WP_001241357.1.94892 WP_001241357.1.94898 WP_001241357.1.94927 WP_001241357.1.94935 WP_001241357.1.94938 WP_001241357.1.94949 WP_001241357.1.94955 WP_001241357.1.94991 WP_001241357.1.94993 WP_001241357.1.94997 WP_001241357.1.95011 WP_001241357.1.95022 WP_001241357.1.95028 WP_001241357.1.95035 WP_001241357.1.95037 WP_001241357.1.95080 WP_001241357.1.95084 WP_001241357.1.95105 WP_001241357.1.95129 WP_001241357.1.95254 WP_001241357.1.95275 WP_001241357.1.95310 WP_001241357.1.95329 WP_001241357.1.95332 WP_001241357.1.95364 WP_001241357.1.95366 WP_001241357.1.95368 WP_001241357.1.95378 WP_001241357.1.95390 WP_001241357.1.95395 WP_001241357.1.95398 WP_001241357.1.95400 WP_001241357.1.95424 WP_001241357.1.95428 WP_001241357.1.95438 WP_001241357.1.95449 WP_001241357.1.95490 WP_001241357.1.95518 WP_001241357.1.95521 WP_001241357.1.95595 WP_001241357.1.95611 WP_001241357.1.95628 WP_001241357.1.95634 WP_001241357.1.9566 WP_001241357.1.95666 WP_001241357.1.95712 WP_001241357.1.95783 WP_001241357.1.95784 WP_001241357.1.95801 WP_001241357.1.95827 WP_001241357.1.95834 WP_001241357.1.95846 WP_001241357.1.95849 WP_001241357.1.95858 WP_001241357.1.95861 WP_001241357.1.95919 WP_001241357.1.95929 WP_001241357.1.95931 WP_001241357.1.95932 WP_001241357.1.95951 WP_001241357.1.960 WP_001241357.1.96059 WP_001241357.1.96097 WP_001241357.1.96110 WP_001241357.1.96128 WP_001241357.1.96143 WP_001241357.1.96145 WP_001241357.1.9616 WP_001241357.1.96215 WP_001241357.1.96223 WP_001241357.1.96229 WP_001241357.1.96253 WP_001241357.1.96263 WP_001241357.1.96278 WP_001241357.1.96279 WP_001241357.1.96290 WP_001241357.1.96299 WP_001241357.1.96303 WP_001241357.1.9631 WP_001241357.1.96339 WP_001241357.1.96341 WP_001241357.1.96378 WP_001241357.1.96392 WP_001241357.1.96394 WP_001241357.1.9641 WP_001241357.1.96417 WP_001241357.1.96425 WP_001241357.1.96450 WP_001241357.1.96478 WP_001241357.1.96480 WP_001241357.1.9649 WP_001241357.1.965 WP_001241357.1.96519 WP_001241357.1.96541 WP_001241357.1.96558 WP_001241357.1.96562 WP_001241357.1.9657 WP_001241357.1.96608 WP_001241357.1.96609 WP_001241357.1.9661 WP_001241357.1.96617 WP_001241357.1.96633 WP_001241357.1.96650 WP_001241357.1.96659 WP_001241357.1.96676 WP_001241357.1.9668 WP_001241357.1.96680 WP_001241357.1.96695 WP_001241357.1.9671 WP_001241357.1.96725 WP_001241357.1.96743 WP_001241357.1.96759 WP_001241357.1.96762 WP_001241357.1.96769 WP_001241357.1.96796 WP_001241357.1.96797 WP_001241357.1.9682 WP_001241357.1.96820 WP_001241357.1.96864 WP_001241357.1.96894 WP_001241357.1.9690 WP_001241357.1.96907 WP_001241357.1.96932 WP_001241357.1.96936 WP_001241357.1.96944 WP_001241357.1.96971 WP_001241357.1.96984 WP_001241357.1.97011 WP_001241357.1.97027 WP_001241357.1.97059 WP_001241357.1.97119 WP_001241357.1.97123 WP_001241357.1.97147 WP_001241357.1.97160 WP_001241357.1.97170 WP_001241357.1.97193 WP_001241357.1.97226 WP_001241357.1.9723 WP_001241357.1.97238 WP_001241357.1.97247 WP_001241357.1.97269 WP_001241357.1.97279 WP_001241357.1.97282 WP_001241357.1.9729 WP_001241357.1.97292 WP_001241357.1.97351 WP_001241357.1.97356 WP_001241357.1.97360 WP_001241357.1.97379 WP_001241357.1.97387 WP_001241357.1.9740 WP_001241357.1.97402 WP_001241357.1.97418 WP_001241357.1.97421 WP_001241357.1.97437 WP_001241357.1.97439 WP_001241357.1.97464 WP_001241357.1.97490 WP_001241357.1.97502 WP_001241357.1.97513 WP_001241357.1.97525 WP_001241357.1.97538 WP_001241357.1.97549 WP_001241357.1.97560 WP_001241357.1.97571 WP_001241357.1.97619 WP_001241357.1.97632 WP_001241357.1.97654 WP_001241357.1.97667 WP_001241357.1.97677 WP_001241357.1.97685 WP_001241357.1.9770 WP_001241357.1.97705 WP_001241357.1.97770 WP_001241357.1.97778 WP_001241357.1.97789 WP_001241357.1.97798 WP_001241357.1.97815 WP_001241357.1.97823 WP_001241357.1.97825 WP_001241357.1.97871 WP_001241357.1.97890 WP_001241357.1.97919 WP_001241357.1.97930 WP_001241357.1.97932 WP_001241357.1.97937 WP_001241357.1.97962 WP_001241357.1.97982 WP_001241357.1.97996 WP_001241357.1.98000 WP_001241357.1.98005 WP_001241357.1.9803 WP_001241357.1.98046 WP_001241357.1.98082 WP_001241357.1.98083 WP_001241357.1.981 WP_001241357.1.98102 WP_001241357.1.98139 WP_001241357.1.98155 WP_001241357.1.98167 WP_001241357.1.98176 WP_001241357.1.98187 WP_001241357.1.98202 WP_001241357.1.98205 WP_001241357.1.98220 WP_001241357.1.98235 WP_001241357.1.98239 WP_001241357.1.98244 WP_001241357.1.98251 WP_001241357.1.98279 WP_001241357.1.98294 WP_001241357.1.98312 WP_001241357.1.98323 WP_001241357.1.98384 WP_001241357.1.98400 WP_001241357.1.98404 WP_001241357.1.98424 WP_001241357.1.98429 WP_001241357.1.9844 WP_001241357.1.98442 WP_001241357.1.98451 WP_001241357.1.98466 WP_001241357.1.98477 WP_001241357.1.98480 WP_001241357.1.98484 WP_001241357.1.98543 WP_001241357.1.98569 WP_001241357.1.98578 WP_001241357.1.9858 WP_001241357.1.98614 WP_001241357.1.98626 WP_001241357.1.98628 WP_001241357.1.98633 WP_001241357.1.98683 WP_001241357.1.98727 WP_001241357.1.98757 WP_001241357.1.98775 WP_001241357.1.98776 WP_001241357.1.98784 WP_001241357.1.98795 WP_001241357.1.9883 WP_001241357.1.98849 WP_001241357.1.98875 WP_001241357.1.98920 WP_001241357.1.98988 WP_001241357.1.99006 WP_001241357.1.99029 WP_001241357.1.99046 WP_001241357.1.99060 WP_001241357.1.99101 WP_001241357.1.99119 WP_001241357.1.99168 WP_001241357.1.99182 WP_001241357.1.99209 WP_001241357.1.99234 WP_001241357.1.99265 WP_001241357.1.99289 WP_001241357.1.99292 WP_001241357.1.99295 WP_001241357.1.9930 WP_001241357.1.99302 WP_001241357.1.99304 WP_001241357.1.99306 WP_001241357.1.99307 WP_001241357.1.99310 WP_001241357.1.99319 WP_001241357.1.99349 WP_001241357.1.9935 WP_001241357.1.99361 WP_001241357.1.99366 WP_001241357.1.99392 WP_001241357.1.99400 WP_001241357.1.99401 WP_001241357.1.99446 WP_001241357.1.99453 WP_001241357.1.99458 WP_001241357.1.99472 WP_001241357.1.99475 WP_001241357.1.99486 WP_001241357.1.99487 WP_001241357.1.99498 WP_001241357.1.9950 WP_001241357.1.99501 WP_001241357.1.99534 WP_001241357.1.99549 WP_001241357.1.99562 WP_001241357.1.99571 WP_001241357.1.99592 WP_001241357.1.99602 WP_001241357.1.99603 WP_001241357.1.99692 WP_001241357.1.99694 WP_001241357.1.99698 WP_001241357.1.99771 WP_001241357.1.99782 WP_001241357.1.99874 WP_001241357.1.99891 WP_001241357.1.99892 WP_001241357.1.99986 YP_002408670.1.10275 YP_002413553.1.14968 YP_006120869.1.29421 YP_006778060.1.12065 YP_404263.1.10455 gi|218701041|ref|YP_002408670.1| gi|387608181|ref|YP_006097037.1| gi|16130456|ref|NP_417026.1| gi|410481477|ref|YP_006769023.1| gi|218706034|ref|YP_002413553.1| gi|386600510|ref|YP_006102016.1| ER651 YFHP_ECOLI gi|407480911|ref|YP_006778060.1| gi|384544148|ref|YP_005728211.1| gi|254162505|ref|YP_003045613.1| gi|187732827|ref|YP_001881322.1| gi|24113860|ref|NP_708370.1| gi|471334203|ref|YP_007557680.1| gi|386620139|ref|YP_006139719.1| gi|378712008|ref|YP_005276901.1| gi|253772573|ref|YP_003035404.1| gi|387507900|ref|YP_006160156.1| gi|386710421|ref|YP_006174142.1| gi|386705796|ref|YP_006169643.1| gi|387883729|ref|YP_006314031.1| gi|30063921|ref|NP_838092.1| gi|91211858|ref|YP_541844.1| gi|251785858|ref|YP_003000162.1| gi|386640062|ref|YP_006106860.1| gi|386710421|ref|YP_006174142.1| gi|157158615|ref|YP_001463854.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]