SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384544928|ref|YP_005728992.1| from Shigella flexneri 2002017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384544928|ref|YP_005728992.1|
Domain Number 1 Region: 527-702
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.2e-46
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0029
Further Details:      
 
Domain Number 2 Region: 2-203
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-38
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0036
Further Details:      
 
Domain Number 3 Region: 396-521
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.58e-31
Family Duplicated SiR/NiR-like domains 1 and 3 0.0076
Further Details:      
 
Weak hits

Sequence:  gi|384544928|ref|YP_005728992.1|
Domain Number - Region: 239-294
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00623
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384544928|ref|YP_005728992.1|
Sequence length 741
Comment Nitrite reductase (NAD(P)H) subunit [Shigella flexneri 2002017]
Sequence
MATGSYPWIPPIKGSDTQDCFVYRTIEDLNAIESCARRSKRGAVVGGGLLGLEAAGALKN
LGIETHVIEFAPMLMAEQLDQMGGEQLRRKIESMGVRVHTSKNTLEIVQEGVEARKTMRF
ADGSELEVDFIVFSTGIRPRDKLATQCGLDVAPRGGIVINDSCQTSDPDIYAIGECASWN
NRVFGLVAPGYKMAQVAVDHILGSENAFEGADLSAKLKLLGVDVGGIGDAHGRTPGARSY
VYLDESKEIYKRLIVSEDNKTLLGAVLVGDTSDYGNLLQLVLNAIELPENPDSLILPAHS
GSGKPSIGVDKLPDSAQICSCFDVTKGDLIAAINKGCHTVAALKAETKAGTGCGGCIPLV
TQVLNAELAKQGIEVNNNLCEHFAYSRQELFHLIRVEGIKTFEELLAKHGKGYGCEVCKP
TVGSLLASCWNEYILKPEHTPLQDSNDNFLANIQKDGTYSVIPRSPGGEITPEGLMAVGR
IAREFNLYTKITGSQRLAMFGAQKDDLPEIWRQLIEAGFETGHAYAKALRMAKTCVGSTW
CRYGVGDSVGLGVELENRYKGIRTPHKMKFGVSGCTRECSEAQGKDVGIIATEKGWNLYV
CGNGGMKPRHADLLAADIDRETLIKYLDRFMMFYIRTADKLTRTAPWLENLEGGIDYLKA
VIIDDKLGLNAHLEEEMARLREAVVCEWTETVNTPSAQTRFKHFINSDKRDPNVQMVPER
EQHRPATPYERIPVTLVEDNA
Download sequence
Identical sequences D2A9G4
gi|384544928|ref|YP_005728992.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]