SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384544973|ref|YP_005729037.1| from Shigella flexneri 2002017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384544973|ref|YP_005729037.1|
Domain Number 1 Region: 4-79
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.39e-24
Family Hypothetical protein YhgG 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384544973|ref|YP_005729037.1|
Sequence length 81
Comment Ferrous iron transport protein C [Shigella flexneri 2002017]
Sequence
MPLMASLIQVRDLLALRGRMEATQISQTLNTPQPMINAMLQQLESMGKAVRIQEEPDGCL
SGSCKSCPEGKACLREWWALR
Download sequence
Identical sequences A0A0F6MIM5 D2A9K9
gi|384544973|ref|YP_005729037.1| 373384.SFV_3415 gi|110807242|ref|YP_690762.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]