SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384545853|ref|YP_005729917.1| from Shigella flexneri 2002017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384545853|ref|YP_005729917.1|
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.37e-34
Family GntR-like transcriptional regulators 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384545853|ref|YP_005729917.1|
Sequence length 141
Comment HTH-type transcriptional repressor nsrR [Shigella flexneri 2002017]
Sequence
MQLTSFTDYGLRALIYMASLPEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRG
KNGGIRLGKPASAIRIGDVVRELEPLSLVNCSSEFCHITPACRLKQALSKAVQSFLTELD
NYTLADLVEENQPLYKLLLVE
Download sequence
Identical sequences A0A017I843 A0A023Z6Q1 A0A024KN87 A0A025CL46 A0A027U592 A0A028AL60 A0A028E9H7 A0A029HCY9 A0A029IHI3 A0A064T1K9 A0A069XPE5 A0A070F8Z3 A0A070SZQ3 A0A070UR68 A0A073FKS6 A0A073H0R2 A0A073UX72 A0A074HMA0 A0A080FMK1 A0A080IDP8 A0A090NNM1 A0A0A8UBH1 A0A0E0U863 A0A0E0VEF3 A0A0E0Y523 A0A0E1M4Y5 A0A0E2LBN5 A0A0F6CCD4 A0A0F6MKP1 A0A0G3KAQ7 A0A0H3ETF3 A0A0H3PZ43 A0A0I1H2B2 A0A0K9TKH4 A0A0M9J4G8 A0A0S3N1Z4 A0A125WVH7 A0A127GT78 A0A181WPY9 A0A192CGX2 A0A1E2VLZ5 A0A1E3N4P8 A0A1Q8M3T1 A0A1S6TJ18 A0A1S9KGI9 A0A1W2MSS6 A0A1X3HXV9 A0A1X3J968 A0A1X3K130 A0A1X3KIP2 A0A1X3KMT1 A0A1X3L866 A0A1X3M2K0 A0A1X3M3T7 A0A1Z3UW67 A0A222QTN7 A0A226K517 A0A2H1BQR2 A0A2I8C990 A1AJ83 B1LQJ8 B1XDS9 B3X5B7 B7LC37 B7MLI3 B7MSJ6 B7NGB2 B7NTN4 B7UQI7 C3SG12 C4ZR55 C8U0E0 C8UM09 D2AF56 D3GVX8 D3QL95 D6I473 D6IHB6 D6J5F6 E2XE05 E7SXK0 E7T8C2 E9XRK8 E9YWX1 F3VES0 F3WRL1 F4SSP4 F4T7X7 F4TP80 F4UY10 F4VMG9 G0F6A9 H4J2H4 H4USN3 I2RC50 I2RRD9 I2SPV7 I2URR6 I2W9G4 I2WRK3 I2XFH2 I6B6M3 I6CT49 I6DA27 I6HHN3 J7QUF1 K0WS58 K4WGM4 K4Y4Z7 L2VL61 L2X130 L3BXU2 L3PEQ8 L3PRT9 L3Q3Z2 L4JIR0 L4UV44 M9GFM6 P0AF63 P0AF64 P0AF65 P0AF66 Q0SXA4 Q0T9L5 Q1R382 Q31TA8 Q328F7 Q3YUG5 R8WQ14 S0UGV9 S0UWE5 S0WC86 S0XJV4 S0YPH3 S1CFE3 S1G9D5 S1J321 S1L6F1 T5UA45 T5ZCJ6 T6GRP2 T6LMH8 T8JYI6 T9BR75 T9S5X2 V8F2H7 V8KGV3 W1F054 W1X0H5 W9A014
gi|386621934|ref|YP_006141514.1| gi|215489522|ref|YP_002331953.1| gi|386606766|ref|YP_006113066.1| gi|386637105|ref|YP_006156824.1| gi|218692512|ref|YP_002400724.1| gi|291285590|ref|YP_003502408.1| gi|387619566|ref|YP_006122588.1| 396723 APC28361 YJEB_ECO57 YJEB_ECOLI gi|386632185|ref|YP_006151905.1| gi|407484057|ref|YP_006781207.1| gi|24115533|ref|NP_710043.1| 155864.Z5785 198214.SF4333 198215.S4601 199310.c5262 300267.SDY_4411 300268.SBO_4278 300269.SSON_4363 316385.ECDH10B_4373 316407.yjeB 362663.ECP_4423 364106.UTI89_C4778 373384.SFV_4336 386585.ECs5154 405955.APECO1_2214 439855.EcSMS35_4649 511145.b4178 573235.ECO26_5344 574521.E2348C_4501 585035.ECS88_4764 585055.EC55989_4733 585056.ECUMN_4711 585057.ECIAI39_4643 585395.ECO103_4971 585396.ECO111_5036 585397.ECED1_4963 595496.BWG_3890 gi|16132000|ref|NP_418599.1| gi|260858331|ref|YP_003232222.1| gi|386641853|ref|YP_006108651.1| gi|443615691|ref|YP_007379547.1| gi|117626524|ref|YP_859847.1| gi|560160508|ref|YP_008853223.1| gi|407467224|ref|YP_006786334.1| gi|387509635|ref|YP_006161891.1| gi|387623808|ref|YP_006131436.1| gi|82779440|ref|YP_405789.1| gi|260870914|ref|YP_003237316.1| gi|15804767|ref|NP_290808.1| gi|556553997|ref|YP_008724577.1| gi|387623808|ref|YP_006131436.1| gi|74314663|ref|YP_313082.1| gi|91213727|ref|YP_543713.1| NP_313181.1.58667 NP_418599.1.90541 NP_710043.1.23235 WP_001177639.1.100014 WP_001177639.1.100044 WP_001177639.1.100063 WP_001177639.1.100066 WP_001177639.1.100073 WP_001177639.1.100085 WP_001177639.1.10010 WP_001177639.1.100111 WP_001177639.1.100116 WP_001177639.1.100135 WP_001177639.1.100138 WP_001177639.1.100151 WP_001177639.1.100159 WP_001177639.1.100194 WP_001177639.1.100220 WP_001177639.1.100227 WP_001177639.1.100252 WP_001177639.1.100281 WP_001177639.1.100283 WP_001177639.1.100285 WP_001177639.1.100299 WP_001177639.1.100304 WP_001177639.1.100306 WP_001177639.1.100315 WP_001177639.1.10034 WP_001177639.1.100346 WP_001177639.1.100389 WP_001177639.1.100425 WP_001177639.1.100441 WP_001177639.1.100447 WP_001177639.1.100448 WP_001177639.1.100451 WP_001177639.1.100474 WP_001177639.1.10048 WP_001177639.1.100499 WP_001177639.1.100508 WP_001177639.1.10051 WP_001177639.1.100531 WP_001177639.1.100543 WP_001177639.1.100571 WP_001177639.1.100573 WP_001177639.1.100614 WP_001177639.1.10067 WP_001177639.1.100688 WP_001177639.1.100689 WP_001177639.1.100718 WP_001177639.1.100725 WP_001177639.1.100735 WP_001177639.1.100738 WP_001177639.1.100758 WP_001177639.1.100778 WP_001177639.1.100796 WP_001177639.1.10080 WP_001177639.1.100803 WP_001177639.1.100824 WP_001177639.1.100836 WP_001177639.1.100851 WP_001177639.1.100852 WP_001177639.1.10086 WP_001177639.1.100898 WP_001177639.1.100916 WP_001177639.1.100925 WP_001177639.1.100928 WP_001177639.1.100933 WP_001177639.1.10094 WP_001177639.1.100959 WP_001177639.1.10100 WP_001177639.1.101033 WP_001177639.1.101052 WP_001177639.1.101087 WP_001177639.1.101096 WP_001177639.1.1011 WP_001177639.1.101110 WP_001177639.1.101121 WP_001177639.1.101148 WP_001177639.1.101152 WP_001177639.1.101157 WP_001177639.1.101158 WP_001177639.1.101175 WP_001177639.1.101186 WP_001177639.1.101214 WP_001177639.1.101216 WP_001177639.1.101255 WP_001177639.1.101257 WP_001177639.1.101282 WP_001177639.1.101289 WP_001177639.1.101293 WP_001177639.1.10131 WP_001177639.1.101313 WP_001177639.1.101359 WP_001177639.1.10138 WP_001177639.1.101399 WP_001177639.1.101418 WP_001177639.1.101423 WP_001177639.1.101429 WP_001177639.1.101430 WP_001177639.1.101436 WP_001177639.1.101439 WP_001177639.1.101445 WP_001177639.1.101468 WP_001177639.1.101486 WP_001177639.1.101522 WP_001177639.1.10154 WP_001177639.1.101545 WP_001177639.1.101583 WP_001177639.1.101586 WP_001177639.1.101594 WP_001177639.1.101630 WP_001177639.1.101653 WP_001177639.1.101654 WP_001177639.1.101667 WP_001177639.1.101668 WP_001177639.1.101693 WP_001177639.1.101694 WP_001177639.1.101700 WP_001177639.1.101727 WP_001177639.1.101737 WP_001177639.1.101747 WP_001177639.1.101769 WP_001177639.1.101777 WP_001177639.1.101786 WP_001177639.1.10181 WP_001177639.1.101822 WP_001177639.1.10184 WP_001177639.1.101840 WP_001177639.1.101845 WP_001177639.1.101855 WP_001177639.1.101865 WP_001177639.1.10188 WP_001177639.1.101887 WP_001177639.1.101889 WP_001177639.1.10190 WP_001177639.1.101900 WP_001177639.1.101908 WP_001177639.1.101913 WP_001177639.1.101926 WP_001177639.1.101932 WP_001177639.1.101935 WP_001177639.1.101937 WP_001177639.1.101940 WP_001177639.1.101942 WP_001177639.1.101947 WP_001177639.1.101948 WP_001177639.1.101952 WP_001177639.1.101962 WP_001177639.1.101977 WP_001177639.1.101984 WP_001177639.1.102021 WP_001177639.1.102036 WP_001177639.1.10206 WP_001177639.1.102069 WP_001177639.1.102076 WP_001177639.1.102093 WP_001177639.1.102094 WP_001177639.1.102104 WP_001177639.1.102106 WP_001177639.1.102122 WP_001177639.1.102144 WP_001177639.1.10222 WP_001177639.1.10226 WP_001177639.1.10235 WP_001177639.1.10252 WP_001177639.1.10273 WP_001177639.1.10304 WP_001177639.1.10326 WP_001177639.1.10329 WP_001177639.1.10348 WP_001177639.1.10352 WP_001177639.1.10361 WP_001177639.1.10379 WP_001177639.1.10381 WP_001177639.1.10417 WP_001177639.1.10461 WP_001177639.1.10476 WP_001177639.1.10491 WP_001177639.1.10492 WP_001177639.1.10496 WP_001177639.1.10508 WP_001177639.1.10524 WP_001177639.1.10525 WP_001177639.1.10538 WP_001177639.1.10569 WP_001177639.1.10573 WP_001177639.1.10576 WP_001177639.1.10579 WP_001177639.1.10605 WP_001177639.1.10607 WP_001177639.1.10628 WP_001177639.1.10673 WP_001177639.1.10697 WP_001177639.1.10705 WP_001177639.1.1071 WP_001177639.1.10715 WP_001177639.1.10729 WP_001177639.1.1073 WP_001177639.1.1074 WP_001177639.1.10744 WP_001177639.1.10748 WP_001177639.1.10761 WP_001177639.1.10763 WP_001177639.1.10771 WP_001177639.1.10786 WP_001177639.1.10798 WP_001177639.1.10809 WP_001177639.1.10814 WP_001177639.1.10824 WP_001177639.1.10833 WP_001177639.1.10842 WP_001177639.1.10849 WP_001177639.1.10862 WP_001177639.1.10869 WP_001177639.1.10940 WP_001177639.1.10988 WP_001177639.1.10995 WP_001177639.1.11047 WP_001177639.1.11052 WP_001177639.1.11057 WP_001177639.1.11068 WP_001177639.1.1111 WP_001177639.1.11113 WP_001177639.1.11118 WP_001177639.1.1113 WP_001177639.1.11133 WP_001177639.1.112 WP_001177639.1.11217 WP_001177639.1.11250 WP_001177639.1.11251 WP_001177639.1.11265 WP_001177639.1.11272 WP_001177639.1.11285 WP_001177639.1.11296 WP_001177639.1.11301 WP_001177639.1.11315 WP_001177639.1.11323 WP_001177639.1.11399 WP_001177639.1.11408 WP_001177639.1.1141 WP_001177639.1.11411 WP_001177639.1.11418 WP_001177639.1.11436 WP_001177639.1.11440 WP_001177639.1.11452 WP_001177639.1.11467 WP_001177639.1.11499 WP_001177639.1.11519 WP_001177639.1.11524 WP_001177639.1.11531 WP_001177639.1.11542 WP_001177639.1.11575 WP_001177639.1.11595 WP_001177639.1.11607 WP_001177639.1.11608 WP_001177639.1.11612 WP_001177639.1.11616 WP_001177639.1.11645 WP_001177639.1.11673 WP_001177639.1.11690 WP_001177639.1.11748 WP_001177639.1.11759 WP_001177639.1.1176 WP_001177639.1.11762 WP_001177639.1.11801 WP_001177639.1.11844 WP_001177639.1.11912 WP_001177639.1.11948 WP_001177639.1.11949 WP_001177639.1.11955 WP_001177639.1.11956 WP_001177639.1.11981 WP_001177639.1.11982 WP_001177639.1.11985 WP_001177639.1.12000 WP_001177639.1.12009 WP_001177639.1.12010 WP_001177639.1.12076 WP_001177639.1.12088 WP_001177639.1.12095 WP_001177639.1.12111 WP_001177639.1.12112 WP_001177639.1.12115 WP_001177639.1.1212 WP_001177639.1.12151 WP_001177639.1.12157 WP_001177639.1.12174 WP_001177639.1.1218 WP_001177639.1.12204 WP_001177639.1.12230 WP_001177639.1.12259 WP_001177639.1.12268 WP_001177639.1.12279 WP_001177639.1.12292 WP_001177639.1.12295 WP_001177639.1.12305 WP_001177639.1.12319 WP_001177639.1.12344 WP_001177639.1.12352 WP_001177639.1.12415 WP_001177639.1.1242 WP_001177639.1.12426 WP_001177639.1.12459 WP_001177639.1.12468 WP_001177639.1.12542 WP_001177639.1.12552 WP_001177639.1.12558 WP_001177639.1.12566 WP_001177639.1.12574 WP_001177639.1.12582 WP_001177639.1.12594 WP_001177639.1.12623 WP_001177639.1.12645 WP_001177639.1.12646 WP_001177639.1.12679 WP_001177639.1.12680 WP_001177639.1.12693 WP_001177639.1.12697 WP_001177639.1.127 WP_001177639.1.12709 WP_001177639.1.12717 WP_001177639.1.12743 WP_001177639.1.12749 WP_001177639.1.12756 WP_001177639.1.12761 WP_001177639.1.12762 WP_001177639.1.12763 WP_001177639.1.12766 WP_001177639.1.1278 WP_001177639.1.12781 WP_001177639.1.1280 WP_001177639.1.12826 WP_001177639.1.12830 WP_001177639.1.12831 WP_001177639.1.12893 WP_001177639.1.12914 WP_001177639.1.12915 WP_001177639.1.1295 WP_001177639.1.12956 WP_001177639.1.12965 WP_001177639.1.12976 WP_001177639.1.12979 WP_001177639.1.12991 WP_001177639.1.13031 WP_001177639.1.13060 WP_001177639.1.13074 WP_001177639.1.1308 WP_001177639.1.13117 WP_001177639.1.1312 WP_001177639.1.13136 WP_001177639.1.13144 WP_001177639.1.1315 WP_001177639.1.13157 WP_001177639.1.13162 WP_001177639.1.13176 WP_001177639.1.13181 WP_001177639.1.13205 WP_001177639.1.13217 WP_001177639.1.13222 WP_001177639.1.1323 WP_001177639.1.13239 WP_001177639.1.13258 WP_001177639.1.13271 WP_001177639.1.13272 WP_001177639.1.13278 WP_001177639.1.13281 WP_001177639.1.13295 WP_001177639.1.13332 WP_001177639.1.13333 WP_001177639.1.13346 WP_001177639.1.13348 WP_001177639.1.1335 WP_001177639.1.13383 WP_001177639.1.13393 WP_001177639.1.13409 WP_001177639.1.13411 WP_001177639.1.1343 WP_001177639.1.13430 WP_001177639.1.13437 WP_001177639.1.13442 WP_001177639.1.1345 WP_001177639.1.13469 WP_001177639.1.13473 WP_001177639.1.13481 WP_001177639.1.13492 WP_001177639.1.13566 WP_001177639.1.13585 WP_001177639.1.13589 WP_001177639.1.13600 WP_001177639.1.13608 WP_001177639.1.13618 WP_001177639.1.13626 WP_001177639.1.13656 WP_001177639.1.13662 WP_001177639.1.13664 WP_001177639.1.13740 WP_001177639.1.13778 WP_001177639.1.13798 WP_001177639.1.13877 WP_001177639.1.13891 WP_001177639.1.13934 WP_001177639.1.13936 WP_001177639.1.13939 WP_001177639.1.13944 WP_001177639.1.13949 WP_001177639.1.13979 WP_001177639.1.13981 WP_001177639.1.14023 WP_001177639.1.14030 WP_001177639.1.14042 WP_001177639.1.14058 WP_001177639.1.14062 WP_001177639.1.14070 WP_001177639.1.14094 WP_001177639.1.14110 WP_001177639.1.14127 WP_001177639.1.14144 WP_001177639.1.14154 WP_001177639.1.14164 WP_001177639.1.142 WP_001177639.1.14245 WP_001177639.1.14253 WP_001177639.1.14277 WP_001177639.1.14299 WP_001177639.1.14322 WP_001177639.1.14331 WP_001177639.1.14346 WP_001177639.1.14371 WP_001177639.1.14389 WP_001177639.1.1439 WP_001177639.1.14398 WP_001177639.1.14417 WP_001177639.1.14445 WP_001177639.1.14451 WP_001177639.1.14453 WP_001177639.1.14493 WP_001177639.1.14499 WP_001177639.1.14501 WP_001177639.1.14506 WP_001177639.1.14508 WP_001177639.1.14509 WP_001177639.1.14529 WP_001177639.1.14538 WP_001177639.1.14581 WP_001177639.1.14601 WP_001177639.1.14605 WP_001177639.1.14607 WP_001177639.1.1461 WP_001177639.1.14616 WP_001177639.1.14621 WP_001177639.1.14648 WP_001177639.1.14672 WP_001177639.1.14687 WP_001177639.1.14693 WP_001177639.1.1470 WP_001177639.1.14711 WP_001177639.1.14712 WP_001177639.1.14746 WP_001177639.1.14748 WP_001177639.1.14749 WP_001177639.1.14807 WP_001177639.1.14811 WP_001177639.1.14833 WP_001177639.1.1486 WP_001177639.1.14861 WP_001177639.1.14871 WP_001177639.1.14914 WP_001177639.1.14934 WP_001177639.1.14946 WP_001177639.1.14956 WP_001177639.1.14958 WP_001177639.1.14963 WP_001177639.1.14965 WP_001177639.1.14977 WP_001177639.1.14993 WP_001177639.1.15007 WP_001177639.1.15020 WP_001177639.1.15068 WP_001177639.1.1508 WP_001177639.1.15087 WP_001177639.1.15090 WP_001177639.1.1510 WP_001177639.1.1512 WP_001177639.1.15121 WP_001177639.1.15138 WP_001177639.1.15148 WP_001177639.1.15177 WP_001177639.1.15191 WP_001177639.1.15221 WP_001177639.1.1524 WP_001177639.1.15245 WP_001177639.1.15252 WP_001177639.1.15259 WP_001177639.1.15274 WP_001177639.1.15277 WP_001177639.1.15287 WP_001177639.1.15290 WP_001177639.1.15300 WP_001177639.1.15304 WP_001177639.1.15332 WP_001177639.1.15335 WP_001177639.1.15347 WP_001177639.1.15356 WP_001177639.1.15420 WP_001177639.1.15453 WP_001177639.1.15464 WP_001177639.1.15496 WP_001177639.1.1550 WP_001177639.1.15503 WP_001177639.1.15528 WP_001177639.1.15538 WP_001177639.1.15565 WP_001177639.1.15576 WP_001177639.1.1559 WP_001177639.1.15593 WP_001177639.1.1561 WP_001177639.1.15624 WP_001177639.1.15626 WP_001177639.1.15645 WP_001177639.1.15654 WP_001177639.1.15702 WP_001177639.1.15707 WP_001177639.1.15747 WP_001177639.1.15762 WP_001177639.1.15767 WP_001177639.1.15768 WP_001177639.1.15771 WP_001177639.1.15782 WP_001177639.1.15791 WP_001177639.1.1580 WP_001177639.1.15809 WP_001177639.1.1582 WP_001177639.1.15855 WP_001177639.1.15857 WP_001177639.1.15863 WP_001177639.1.1588 WP_001177639.1.15894 WP_001177639.1.15906 WP_001177639.1.15916 WP_001177639.1.15949 WP_001177639.1.15951 WP_001177639.1.15983 WP_001177639.1.15984 WP_001177639.1.15990 WP_001177639.1.16010 WP_001177639.1.16014 WP_001177639.1.16015 WP_001177639.1.16034 WP_001177639.1.1604 WP_001177639.1.16042 WP_001177639.1.16067 WP_001177639.1.16075 WP_001177639.1.16086 WP_001177639.1.16087 WP_001177639.1.1609 WP_001177639.1.16111 WP_001177639.1.16117 WP_001177639.1.16131 WP_001177639.1.16133 WP_001177639.1.16175 WP_001177639.1.16179 WP_001177639.1.16188 WP_001177639.1.16194 WP_001177639.1.1621 WP_001177639.1.1622 WP_001177639.1.16270 WP_001177639.1.16294 WP_001177639.1.16303 WP_001177639.1.16322 WP_001177639.1.16387 WP_001177639.1.16396 WP_001177639.1.16463 WP_001177639.1.16482 WP_001177639.1.16500 WP_001177639.1.16517 WP_001177639.1.16532 WP_001177639.1.16541 WP_001177639.1.1655 WP_001177639.1.16577 WP_001177639.1.16592 WP_001177639.1.16604 WP_001177639.1.16608 WP_001177639.1.16612 WP_001177639.1.16640 WP_001177639.1.16667 WP_001177639.1.16669 WP_001177639.1.16685 WP_001177639.1.16705 WP_001177639.1.16715 WP_001177639.1.16721 WP_001177639.1.1673 WP_001177639.1.16752 WP_001177639.1.16766 WP_001177639.1.16780 WP_001177639.1.16798 WP_001177639.1.16799 WP_001177639.1.16805 WP_001177639.1.16807 WP_001177639.1.16818 WP_001177639.1.16843 WP_001177639.1.16845 WP_001177639.1.16861 WP_001177639.1.16862 WP_001177639.1.16894 WP_001177639.1.16927 WP_001177639.1.16970 WP_001177639.1.16979 WP_001177639.1.16992 WP_001177639.1.17014 WP_001177639.1.17018 WP_001177639.1.17028 WP_001177639.1.17042 WP_001177639.1.17061 WP_001177639.1.17084 WP_001177639.1.17085 WP_001177639.1.17087 WP_001177639.1.17089 WP_001177639.1.17101 WP_001177639.1.17102 WP_001177639.1.17109 WP_001177639.1.17111 WP_001177639.1.17114 WP_001177639.1.17123 WP_001177639.1.17150 WP_001177639.1.17153 WP_001177639.1.17170 WP_001177639.1.17172 WP_001177639.1.17186 WP_001177639.1.17205 WP_001177639.1.17206 WP_001177639.1.17216 WP_001177639.1.17230 WP_001177639.1.17242 WP_001177639.1.1726 WP_001177639.1.17267 WP_001177639.1.17300 WP_001177639.1.17301 WP_001177639.1.1731 WP_001177639.1.17325 WP_001177639.1.17333 WP_001177639.1.17386 WP_001177639.1.17387 WP_001177639.1.17389 WP_001177639.1.17392 WP_001177639.1.17410 WP_001177639.1.17417 WP_001177639.1.17432 WP_001177639.1.17441 WP_001177639.1.17461 WP_001177639.1.17496 WP_001177639.1.1754 WP_001177639.1.1755 WP_001177639.1.17568 WP_001177639.1.17570 WP_001177639.1.17577 WP_001177639.1.17584 WP_001177639.1.17595 WP_001177639.1.17623 WP_001177639.1.1763 WP_001177639.1.17637 WP_001177639.1.1766 WP_001177639.1.17680 WP_001177639.1.17701 WP_001177639.1.17711 WP_001177639.1.1772 WP_001177639.1.17734 WP_001177639.1.17757 WP_001177639.1.17765 WP_001177639.1.17769 WP_001177639.1.1778 WP_001177639.1.17831 WP_001177639.1.17836 WP_001177639.1.17849 WP_001177639.1.17920 WP_001177639.1.17925 WP_001177639.1.17937 WP_001177639.1.17952 WP_001177639.1.17961 WP_001177639.1.17963 WP_001177639.1.17984 WP_001177639.1.18006 WP_001177639.1.1802 WP_001177639.1.18024 WP_001177639.1.18050 WP_001177639.1.18064 WP_001177639.1.18112 WP_001177639.1.18118 WP_001177639.1.18121 WP_001177639.1.18134 WP_001177639.1.18136 WP_001177639.1.18141 WP_001177639.1.1821 WP_001177639.1.18225 WP_001177639.1.18275 WP_001177639.1.18311 WP_001177639.1.18316 WP_001177639.1.18329 WP_001177639.1.18337 WP_001177639.1.1834 WP_001177639.1.18340 WP_001177639.1.18348 WP_001177639.1.18354 WP_001177639.1.18381 WP_001177639.1.18383 WP_001177639.1.18394 WP_001177639.1.18402 WP_001177639.1.18410 WP_001177639.1.18428 WP_001177639.1.18436 WP_001177639.1.18438 WP_001177639.1.1844 WP_001177639.1.18458 WP_001177639.1.18461 WP_001177639.1.18472 WP_001177639.1.18511 WP_001177639.1.18519 WP_001177639.1.18530 WP_001177639.1.18550 WP_001177639.1.18556 WP_001177639.1.18581 WP_001177639.1.18583 WP_001177639.1.1861 WP_001177639.1.18617 WP_001177639.1.1862 WP_001177639.1.18628 WP_001177639.1.18649 WP_001177639.1.18650 WP_001177639.1.18651 WP_001177639.1.18655 WP_001177639.1.1866 WP_001177639.1.18675 WP_001177639.1.18714 WP_001177639.1.18725 WP_001177639.1.18726 WP_001177639.1.1873 WP_001177639.1.18734 WP_001177639.1.18794 WP_001177639.1.188 WP_001177639.1.18801 WP_001177639.1.18802 WP_001177639.1.18806 WP_001177639.1.1881 WP_001177639.1.18828 WP_001177639.1.18843 WP_001177639.1.18858 WP_001177639.1.18861 WP_001177639.1.18874 WP_001177639.1.18876 WP_001177639.1.18899 WP_001177639.1.18908 WP_001177639.1.18923 WP_001177639.1.18934 WP_001177639.1.1896 WP_001177639.1.18962 WP_001177639.1.18966 WP_001177639.1.18983 WP_001177639.1.19024 WP_001177639.1.1903 WP_001177639.1.19036 WP_001177639.1.19039 WP_001177639.1.1909 WP_001177639.1.19090 WP_001177639.1.191 WP_001177639.1.19100 WP_001177639.1.19113 WP_001177639.1.19122 WP_001177639.1.19135 WP_001177639.1.19140 WP_001177639.1.19146 WP_001177639.1.19147 WP_001177639.1.19148 WP_001177639.1.1915 WP_001177639.1.19150 WP_001177639.1.19153 WP_001177639.1.19171 WP_001177639.1.19205 WP_001177639.1.19206 WP_001177639.1.19245 WP_001177639.1.19276 WP_001177639.1.19277 WP_001177639.1.19297 WP_001177639.1.193 WP_001177639.1.19312 WP_001177639.1.19313 WP_001177639.1.19314 WP_001177639.1.19315 WP_001177639.1.19332 WP_001177639.1.19338 WP_001177639.1.19350 WP_001177639.1.19374 WP_001177639.1.19379 WP_001177639.1.19397 WP_001177639.1.19419 WP_001177639.1.19424 WP_001177639.1.19441 WP_001177639.1.19448 WP_001177639.1.19453 WP_001177639.1.19465 WP_001177639.1.19487 WP_001177639.1.19492 WP_001177639.1.19494 WP_001177639.1.1952 WP_001177639.1.19534 WP_001177639.1.19545 WP_001177639.1.19547 WP_001177639.1.19557 WP_001177639.1.19581 WP_001177639.1.19583 WP_001177639.1.19593 WP_001177639.1.1960 WP_001177639.1.19602 WP_001177639.1.19612 WP_001177639.1.1963 WP_001177639.1.19644 WP_001177639.1.19649 WP_001177639.1.19651 WP_001177639.1.19654 WP_001177639.1.19655 WP_001177639.1.19661 WP_001177639.1.19684 WP_001177639.1.19758 WP_001177639.1.19760 WP_001177639.1.19761 WP_001177639.1.19778 WP_001177639.1.1982 WP_001177639.1.19830 WP_001177639.1.19838 WP_001177639.1.19840 WP_001177639.1.19845 WP_001177639.1.19861 WP_001177639.1.1987 WP_001177639.1.19873 WP_001177639.1.19889 WP_001177639.1.19940 WP_001177639.1.19945 WP_001177639.1.19957 WP_001177639.1.19972 WP_001177639.1.20025 WP_001177639.1.20096 WP_001177639.1.20114 WP_001177639.1.20115 WP_001177639.1.20129 WP_001177639.1.20136 WP_001177639.1.20157 WP_001177639.1.20159 WP_001177639.1.20164 WP_001177639.1.20178 WP_001177639.1.20183 WP_001177639.1.20192 WP_001177639.1.20215 WP_001177639.1.2022 WP_001177639.1.20224 WP_001177639.1.20230 WP_001177639.1.20238 WP_001177639.1.20264 WP_001177639.1.2027 WP_001177639.1.20277 WP_001177639.1.20289 WP_001177639.1.20290 WP_001177639.1.20318 WP_001177639.1.20331 WP_001177639.1.20334 WP_001177639.1.20370 WP_001177639.1.20388 WP_001177639.1.20442 WP_001177639.1.20449 WP_001177639.1.20452 WP_001177639.1.20480 WP_001177639.1.20484 WP_001177639.1.20493 WP_001177639.1.20506 WP_001177639.1.20515 WP_001177639.1.20519 WP_001177639.1.20536 WP_001177639.1.20546 WP_001177639.1.20549 WP_001177639.1.20565 WP_001177639.1.20575 WP_001177639.1.20594 WP_001177639.1.20609 WP_001177639.1.2063 WP_001177639.1.20630 WP_001177639.1.20636 WP_001177639.1.20638 WP_001177639.1.20640 WP_001177639.1.20662 WP_001177639.1.20668 WP_001177639.1.20691 WP_001177639.1.20709 WP_001177639.1.20724 WP_001177639.1.20730 WP_001177639.1.20737 WP_001177639.1.20741 WP_001177639.1.20745 WP_001177639.1.2075 WP_001177639.1.20761 WP_001177639.1.20765 WP_001177639.1.20784 WP_001177639.1.20803 WP_001177639.1.20813 WP_001177639.1.20818 WP_001177639.1.20831 WP_001177639.1.20841 WP_001177639.1.20863 WP_001177639.1.20907 WP_001177639.1.2092 WP_001177639.1.2093 WP_001177639.1.20933 WP_001177639.1.2094 WP_001177639.1.20941 WP_001177639.1.20962 WP_001177639.1.20982 WP_001177639.1.20989 WP_001177639.1.2100 WP_001177639.1.21020 WP_001177639.1.21022 WP_001177639.1.21024 WP_001177639.1.21029 WP_001177639.1.21033 WP_001177639.1.21041 WP_001177639.1.21057 WP_001177639.1.21059 WP_001177639.1.21104 WP_001177639.1.21122 WP_001177639.1.21129 WP_001177639.1.2113 WP_001177639.1.21131 WP_001177639.1.21152 WP_001177639.1.21171 WP_001177639.1.21197 WP_001177639.1.21236 WP_001177639.1.21248 WP_001177639.1.21255 WP_001177639.1.21266 WP_001177639.1.21277 WP_001177639.1.21305 WP_001177639.1.21336 WP_001177639.1.21378 WP_001177639.1.21450 WP_001177639.1.21455 WP_001177639.1.21470 WP_001177639.1.21508 WP_001177639.1.21519 WP_001177639.1.21526 WP_001177639.1.21537 WP_001177639.1.2156 WP_001177639.1.21573 WP_001177639.1.21578 WP_001177639.1.21614 WP_001177639.1.21628 WP_001177639.1.21634 WP_001177639.1.21637 WP_001177639.1.21652 WP_001177639.1.21656 WP_001177639.1.21666 WP_001177639.1.21667 WP_001177639.1.21668 WP_001177639.1.21673 WP_001177639.1.21696 WP_001177639.1.21714 WP_001177639.1.21727 WP_001177639.1.21729 WP_001177639.1.21732 WP_001177639.1.21733 WP_001177639.1.21756 WP_001177639.1.21758 WP_001177639.1.21762 WP_001177639.1.21771 WP_001177639.1.21773 WP_001177639.1.21811 WP_001177639.1.21812 WP_001177639.1.21823 WP_001177639.1.21895 WP_001177639.1.21899 WP_001177639.1.21915 WP_001177639.1.21945 WP_001177639.1.21948 WP_001177639.1.21962 WP_001177639.1.2198 WP_001177639.1.21986 WP_001177639.1.21992 WP_001177639.1.22021 WP_001177639.1.22042 WP_001177639.1.22060 WP_001177639.1.22088 WP_001177639.1.22113 WP_001177639.1.22138 WP_001177639.1.22161 WP_001177639.1.22182 WP_001177639.1.22189 WP_001177639.1.22195 WP_001177639.1.22203 WP_001177639.1.22251 WP_001177639.1.22268 WP_001177639.1.22269 WP_001177639.1.22272 WP_001177639.1.22280 WP_001177639.1.22291 WP_001177639.1.22293 WP_001177639.1.22295 WP_001177639.1.22314 WP_001177639.1.2232 WP_001177639.1.22328 WP_001177639.1.22350 WP_001177639.1.22363 WP_001177639.1.22381 WP_001177639.1.22409 WP_001177639.1.2242 WP_001177639.1.22431 WP_001177639.1.2245 WP_001177639.1.22450 WP_001177639.1.22464 WP_001177639.1.22470 WP_001177639.1.22494 WP_001177639.1.22501 WP_001177639.1.22508 WP_001177639.1.22522 WP_001177639.1.22543 WP_001177639.1.22544 WP_001177639.1.22549 WP_001177639.1.22571 WP_001177639.1.22576 WP_001177639.1.22594 WP_001177639.1.22602 WP_001177639.1.22631 WP_001177639.1.22632 WP_001177639.1.22641 WP_001177639.1.22662 WP_001177639.1.22667 WP_001177639.1.22669 WP_001177639.1.22685 WP_001177639.1.22690 WP_001177639.1.22691 WP_001177639.1.22743 WP_001177639.1.22757 WP_001177639.1.22759 WP_001177639.1.22771 WP_001177639.1.22783 WP_001177639.1.22809 WP_001177639.1.22814 WP_001177639.1.22824 WP_001177639.1.22827 WP_001177639.1.22830 WP_001177639.1.22846 WP_001177639.1.22868 WP_001177639.1.22875 WP_001177639.1.22878 WP_001177639.1.22885 WP_001177639.1.22896 WP_001177639.1.22917 WP_001177639.1.22925 WP_001177639.1.22939 WP_001177639.1.22961 WP_001177639.1.22988 WP_001177639.1.22990 WP_001177639.1.22993 WP_001177639.1.2300 WP_001177639.1.23005 WP_001177639.1.23021 WP_001177639.1.23044 WP_001177639.1.23045 WP_001177639.1.23057 WP_001177639.1.23062 WP_001177639.1.23073 WP_001177639.1.23078 WP_001177639.1.23081 WP_001177639.1.23090 WP_001177639.1.23092 WP_001177639.1.23109 WP_001177639.1.23115 WP_001177639.1.23120 WP_001177639.1.2322 WP_001177639.1.23230 WP_001177639.1.23241 WP_001177639.1.2325 WP_001177639.1.23257 WP_001177639.1.23270 WP_001177639.1.23282 WP_001177639.1.23285 WP_001177639.1.23293 WP_001177639.1.23299 WP_001177639.1.23323 WP_001177639.1.23330 WP_001177639.1.23352 WP_001177639.1.23355 WP_001177639.1.23376 WP_001177639.1.23378 WP_001177639.1.23386 WP_001177639.1.23393 WP_001177639.1.23443 WP_001177639.1.23456 WP_001177639.1.23463 WP_001177639.1.23467 WP_001177639.1.23486 WP_001177639.1.23487 WP_001177639.1.23511 WP_001177639.1.23520 WP_001177639.1.23522 WP_001177639.1.23527 WP_001177639.1.2353 WP_001177639.1.23554 WP_001177639.1.23561 WP_001177639.1.23563 WP_001177639.1.23575 WP_001177639.1.23584 WP_001177639.1.23593 WP_001177639.1.2362 WP_001177639.1.23622 WP_001177639.1.23625 WP_001177639.1.23660 WP_001177639.1.23686 WP_001177639.1.23693 WP_001177639.1.23700 WP_001177639.1.23711 WP_001177639.1.23724 WP_001177639.1.23729 WP_001177639.1.23741 WP_001177639.1.23752 WP_001177639.1.23754 WP_001177639.1.23790 WP_001177639.1.23795 WP_001177639.1.23804 WP_001177639.1.23806 WP_001177639.1.23812 WP_001177639.1.23838 WP_001177639.1.23840 WP_001177639.1.23855 WP_001177639.1.23869 WP_001177639.1.2388 WP_001177639.1.23881 WP_001177639.1.23886 WP_001177639.1.23890 WP_001177639.1.23895 WP_001177639.1.23898 WP_001177639.1.23899 WP_001177639.1.23914 WP_001177639.1.23931 WP_001177639.1.23945 WP_001177639.1.2395 WP_001177639.1.23950 WP_001177639.1.23953 WP_001177639.1.23960 WP_001177639.1.23962 WP_001177639.1.23970 WP_001177639.1.23971 WP_001177639.1.23973 WP_001177639.1.23984 WP_001177639.1.23985 WP_001177639.1.24 WP_001177639.1.24004 WP_001177639.1.24024 WP_001177639.1.24038 WP_001177639.1.24045 WP_001177639.1.24051 WP_001177639.1.24058 WP_001177639.1.24068 WP_001177639.1.24070 WP_001177639.1.24088 WP_001177639.1.24089 WP_001177639.1.24120 WP_001177639.1.24122 WP_001177639.1.24124 WP_001177639.1.24127 WP_001177639.1.2413 WP_001177639.1.24136 WP_001177639.1.24169 WP_001177639.1.24177 WP_001177639.1.2418 WP_001177639.1.24194 WP_001177639.1.24233 WP_001177639.1.2428 WP_001177639.1.24283 WP_001177639.1.24290 WP_001177639.1.2430 WP_001177639.1.24304 WP_001177639.1.2433 WP_001177639.1.24341 WP_001177639.1.24362 WP_001177639.1.2437 WP_001177639.1.24381 WP_001177639.1.24458 WP_001177639.1.24460 WP_001177639.1.24485 WP_001177639.1.2449 WP_001177639.1.24523 WP_001177639.1.24524 WP_001177639.1.24533 WP_001177639.1.24536 WP_001177639.1.24547 WP_001177639.1.2456 WP_001177639.1.24560 WP_001177639.1.24570 WP_001177639.1.24575 WP_001177639.1.24577 WP_001177639.1.24583 WP_001177639.1.24592 WP_001177639.1.24634 WP_001177639.1.24641 WP_001177639.1.24642 WP_001177639.1.24646 WP_001177639.1.24650 WP_001177639.1.2469 WP_001177639.1.24695 WP_001177639.1.24703 WP_001177639.1.24752 WP_001177639.1.24753 WP_001177639.1.24758 WP_001177639.1.24763 WP_001177639.1.24773 WP_001177639.1.24783 WP_001177639.1.2479 WP_001177639.1.24791 WP_001177639.1.24797 WP_001177639.1.24799 WP_001177639.1.24808 WP_001177639.1.24849 WP_001177639.1.24854 WP_001177639.1.24870 WP_001177639.1.24876 WP_001177639.1.24899 WP_001177639.1.24902 WP_001177639.1.24906 WP_001177639.1.24909 WP_001177639.1.24926 WP_001177639.1.24929 WP_001177639.1.24939 WP_001177639.1.24960 WP_001177639.1.24968 WP_001177639.1.24979 WP_001177639.1.24981 WP_001177639.1.24982 WP_001177639.1.25019 WP_001177639.1.2502 WP_001177639.1.25021 WP_001177639.1.25038 WP_001177639.1.25042 WP_001177639.1.25060 WP_001177639.1.25076 WP_001177639.1.25079 WP_001177639.1.25082 WP_001177639.1.25085 WP_001177639.1.25086 WP_001177639.1.25087 WP_001177639.1.25088 WP_001177639.1.25126 WP_001177639.1.25141 WP_001177639.1.25174 WP_001177639.1.25183 WP_001177639.1.25193 WP_001177639.1.25201 WP_001177639.1.25203 WP_001177639.1.25204 WP_001177639.1.25248 WP_001177639.1.25270 WP_001177639.1.25272 WP_001177639.1.25289 WP_001177639.1.25305 WP_001177639.1.2531 WP_001177639.1.25324 WP_001177639.1.25346 WP_001177639.1.2537 WP_001177639.1.25372 WP_001177639.1.25378 WP_001177639.1.25380 WP_001177639.1.254 WP_001177639.1.2540 WP_001177639.1.25403 WP_001177639.1.25414 WP_001177639.1.25420 WP_001177639.1.2543 WP_001177639.1.25446 WP_001177639.1.25480 WP_001177639.1.255 WP_001177639.1.25517 WP_001177639.1.25525 WP_001177639.1.25526 WP_001177639.1.25548 WP_001177639.1.25577 WP_001177639.1.2558 WP_001177639.1.25592 WP_001177639.1.25598 WP_001177639.1.25602 WP_001177639.1.25612 WP_001177639.1.25613 WP_001177639.1.25652 WP_001177639.1.2567 WP_001177639.1.25680 WP_001177639.1.25681 WP_001177639.1.25701 WP_001177639.1.25712 WP_001177639.1.25713 WP_001177639.1.25717 WP_001177639.1.25718 WP_001177639.1.25724 WP_001177639.1.25726 WP_001177639.1.25753 WP_001177639.1.25755 WP_001177639.1.25794 WP_001177639.1.25799 WP_001177639.1.25831 WP_001177639.1.25843 WP_001177639.1.25855 WP_001177639.1.25869 WP_001177639.1.25873 WP_001177639.1.25886 WP_001177639.1.2589 WP_001177639.1.25890 WP_001177639.1.25895 WP_001177639.1.25915 WP_001177639.1.25945 WP_001177639.1.2597 WP_001177639.1.26005 WP_001177639.1.26040 WP_001177639.1.26048 WP_001177639.1.26055 WP_001177639.1.2606 WP_001177639.1.26061 WP_001177639.1.26076 WP_001177639.1.26092 WP_001177639.1.2612 WP_001177639.1.26121 WP_001177639.1.26125 WP_001177639.1.26131 WP_001177639.1.26134 WP_001177639.1.26135 WP_001177639.1.26150 WP_001177639.1.26175 WP_001177639.1.26186 WP_001177639.1.26189 WP_001177639.1.26191 WP_001177639.1.26196 WP_001177639.1.26246 WP_001177639.1.26259 WP_001177639.1.26262 WP_001177639.1.26270 WP_001177639.1.26284 WP_001177639.1.26304 WP_001177639.1.26331 WP_001177639.1.26391 WP_001177639.1.26398 WP_001177639.1.26419 WP_001177639.1.2642 WP_001177639.1.26438 WP_001177639.1.26443 WP_001177639.1.26467 WP_001177639.1.26474 WP_001177639.1.26479 WP_001177639.1.26480 WP_001177639.1.26517 WP_001177639.1.26569 WP_001177639.1.26570 WP_001177639.1.26574 WP_001177639.1.26575 WP_001177639.1.26579 WP_001177639.1.26588 WP_001177639.1.26590 WP_001177639.1.26598 WP_001177639.1.26609 WP_001177639.1.26613 WP_001177639.1.26627 WP_001177639.1.2665 WP_001177639.1.26659 WP_001177639.1.26660 WP_001177639.1.26683 WP_001177639.1.26688 WP_001177639.1.26720 WP_001177639.1.26736 WP_001177639.1.26761 WP_001177639.1.26766 WP_001177639.1.26782 WP_001177639.1.26837 WP_001177639.1.26839 WP_001177639.1.26861 WP_001177639.1.2688 WP_001177639.1.26932 WP_001177639.1.2694 WP_001177639.1.26941 WP_001177639.1.26943 WP_001177639.1.2695 WP_001177639.1.26950 WP_001177639.1.26987 WP_001177639.1.26995 WP_001177639.1.2700 WP_001177639.1.27019 WP_001177639.1.27043 WP_001177639.1.27057 WP_001177639.1.27060 WP_001177639.1.27091 WP_001177639.1.27101 WP_001177639.1.27105 WP_001177639.1.27134 WP_001177639.1.27148 WP_001177639.1.27188 WP_001177639.1.27234 WP_001177639.1.27260 WP_001177639.1.27287 WP_001177639.1.2731 WP_001177639.1.27313 WP_001177639.1.27338 WP_001177639.1.27373 WP_001177639.1.27396 WP_001177639.1.27401 WP_001177639.1.27424 WP_001177639.1.27426 WP_001177639.1.27445 WP_001177639.1.2745 WP_001177639.1.27451 WP_001177639.1.27472 WP_001177639.1.27504 WP_001177639.1.27518 WP_001177639.1.27520 WP_001177639.1.27524 WP_001177639.1.27560 WP_001177639.1.27580 WP_001177639.1.27585 WP_001177639.1.27618 WP_001177639.1.27683 WP_001177639.1.27693 WP_001177639.1.27723 WP_001177639.1.27734 WP_001177639.1.27749 WP_001177639.1.27758 WP_001177639.1.27786 WP_001177639.1.2779 WP_001177639.1.27797 WP_001177639.1.2782 WP_001177639.1.27846 WP_001177639.1.27856 WP_001177639.1.27861 WP_001177639.1.27871 WP_001177639.1.27879 WP_001177639.1.27897 WP_001177639.1.27911 WP_001177639.1.27913 WP_001177639.1.27923 WP_001177639.1.27932 WP_001177639.1.2794 WP_001177639.1.27957 WP_001177639.1.27971 WP_001177639.1.27998 WP_001177639.1.28008 WP_001177639.1.28026 WP_001177639.1.28027 WP_001177639.1.28046 WP_001177639.1.28051 WP_001177639.1.28102 WP_001177639.1.28109 WP_001177639.1.2811 WP_001177639.1.28110 WP_001177639.1.28143 WP_001177639.1.28145 WP_001177639.1.28156 WP_001177639.1.28167 WP_001177639.1.28168 WP_001177639.1.28184 WP_001177639.1.28199 WP_001177639.1.2823 WP_001177639.1.28271 WP_001177639.1.28305 WP_001177639.1.28314 WP_001177639.1.28318 WP_001177639.1.28322 WP_001177639.1.28345 WP_001177639.1.28349 WP_001177639.1.28371 WP_001177639.1.2838 WP_001177639.1.28401 WP_001177639.1.28414 WP_001177639.1.28433 WP_001177639.1.28440 WP_001177639.1.28461 WP_001177639.1.28476 WP_001177639.1.28480 WP_001177639.1.28491 WP_001177639.1.285 WP_001177639.1.28500 WP_001177639.1.28509 WP_001177639.1.28523 WP_001177639.1.28540 WP_001177639.1.28554 WP_001177639.1.28639 WP_001177639.1.2866 WP_001177639.1.28662 WP_001177639.1.28683 WP_001177639.1.28697 WP_001177639.1.28711 WP_001177639.1.28723 WP_001177639.1.28732 WP_001177639.1.28734 WP_001177639.1.28736 WP_001177639.1.28742 WP_001177639.1.28760 WP_001177639.1.28762 WP_001177639.1.28769 WP_001177639.1.28791 WP_001177639.1.28809 WP_001177639.1.28829 WP_001177639.1.28835 WP_001177639.1.28842 WP_001177639.1.28863 WP_001177639.1.28919 WP_001177639.1.28924 WP_001177639.1.28982 WP_001177639.1.28994 WP_001177639.1.29016 WP_001177639.1.29049 WP_001177639.1.29055 WP_001177639.1.29061 WP_001177639.1.29079 WP_001177639.1.29082 WP_001177639.1.29100 WP_001177639.1.29118 WP_001177639.1.29125 WP_001177639.1.29126 WP_001177639.1.29128 WP_001177639.1.29146 WP_001177639.1.29150 WP_001177639.1.29164 WP_001177639.1.29197 WP_001177639.1.29221 WP_001177639.1.29230 WP_001177639.1.29252 WP_001177639.1.29258 WP_001177639.1.2931 WP_001177639.1.29377 WP_001177639.1.29394 WP_001177639.1.29404 WP_001177639.1.2942 WP_001177639.1.29429 WP_001177639.1.29443 WP_001177639.1.29486 WP_001177639.1.29495 WP_001177639.1.29497 WP_001177639.1.29504 WP_001177639.1.29513 WP_001177639.1.2952 WP_001177639.1.29523 WP_001177639.1.2954 WP_001177639.1.29556 WP_001177639.1.29564 WP_001177639.1.29590 WP_001177639.1.29597 WP_001177639.1.29603 WP_001177639.1.2963 WP_001177639.1.29643 WP_001177639.1.29647 WP_001177639.1.29662 WP_001177639.1.29669 WP_001177639.1.29683 WP_001177639.1.29699 WP_001177639.1.29715 WP_001177639.1.29724 WP_001177639.1.29740 WP_001177639.1.29746 WP_001177639.1.29798 WP_001177639.1.29815 WP_001177639.1.29819 WP_001177639.1.29820 WP_001177639.1.29821 WP_001177639.1.29840 WP_001177639.1.29855 WP_001177639.1.2986 WP_001177639.1.29874 WP_001177639.1.29876 WP_001177639.1.29884 WP_001177639.1.29893 WP_001177639.1.29933 WP_001177639.1.2995 WP_001177639.1.29967 WP_001177639.1.29976 WP_001177639.1.29979 WP_001177639.1.29988 WP_001177639.1.30 WP_001177639.1.30004 WP_001177639.1.30016 WP_001177639.1.30035 WP_001177639.1.30063 WP_001177639.1.30098 WP_001177639.1.30105 WP_001177639.1.30141 WP_001177639.1.30178 WP_001177639.1.3018 WP_001177639.1.30221 WP_001177639.1.30222 WP_001177639.1.30231 WP_001177639.1.30232 WP_001177639.1.30239 WP_001177639.1.30253 WP_001177639.1.30269 WP_001177639.1.30298 WP_001177639.1.30347 WP_001177639.1.30397 WP_001177639.1.30400 WP_001177639.1.30401 WP_001177639.1.30447 WP_001177639.1.30452 WP_001177639.1.30476 WP_001177639.1.30497 WP_001177639.1.30524 WP_001177639.1.30536 WP_001177639.1.30546 WP_001177639.1.3055 WP_001177639.1.30550 WP_001177639.1.30554 WP_001177639.1.30570 WP_001177639.1.30580 WP_001177639.1.306 WP_001177639.1.3063 WP_001177639.1.30630 WP_001177639.1.30639 WP_001177639.1.30640 WP_001177639.1.30658 WP_001177639.1.30665 WP_001177639.1.30691 WP_001177639.1.30700 WP_001177639.1.30733 WP_001177639.1.30749 WP_001177639.1.30762 WP_001177639.1.30783 WP_001177639.1.30808 WP_001177639.1.3083 WP_001177639.1.30867 WP_001177639.1.30879 WP_001177639.1.30887 WP_001177639.1.30896 WP_001177639.1.309 WP_001177639.1.30905 WP_001177639.1.30906 WP_001177639.1.30960 WP_001177639.1.30987 WP_001177639.1.30993 WP_001177639.1.30999 WP_001177639.1.31000 WP_001177639.1.31017 WP_001177639.1.31026 WP_001177639.1.31029 WP_001177639.1.31055 WP_001177639.1.31083 WP_001177639.1.31089 WP_001177639.1.31119 WP_001177639.1.31129 WP_001177639.1.31142 WP_001177639.1.31149 WP_001177639.1.31154 WP_001177639.1.31188 WP_001177639.1.312 WP_001177639.1.31211 WP_001177639.1.31319 WP_001177639.1.31340 WP_001177639.1.31353 WP_001177639.1.31357 WP_001177639.1.31372 WP_001177639.1.3140 WP_001177639.1.31401 WP_001177639.1.31407 WP_001177639.1.31419 WP_001177639.1.31421 WP_001177639.1.31422 WP_001177639.1.31429 WP_001177639.1.31431 WP_001177639.1.31433 WP_001177639.1.31434 WP_001177639.1.3147 WP_001177639.1.31482 WP_001177639.1.31511 WP_001177639.1.31518 WP_001177639.1.31527 WP_001177639.1.31542 WP_001177639.1.31557 WP_001177639.1.31559 WP_001177639.1.31575 WP_001177639.1.31596 WP_001177639.1.31614 WP_001177639.1.31618 WP_001177639.1.31625 WP_001177639.1.31639 WP_001177639.1.31657 WP_001177639.1.31679 WP_001177639.1.3169 WP_001177639.1.31696 WP_001177639.1.31715 WP_001177639.1.31736 WP_001177639.1.3176 WP_001177639.1.31801 WP_001177639.1.31809 WP_001177639.1.31823 WP_001177639.1.31825 WP_001177639.1.31833 WP_001177639.1.31839 WP_001177639.1.31860 WP_001177639.1.31863 WP_001177639.1.31866 WP_001177639.1.31878 WP_001177639.1.31899 WP_001177639.1.31903 WP_001177639.1.31924 WP_001177639.1.3193 WP_001177639.1.31937 WP_001177639.1.31978 WP_001177639.1.3201 WP_001177639.1.32020 WP_001177639.1.32021 WP_001177639.1.32024 WP_001177639.1.3203 WP_001177639.1.32030 WP_001177639.1.32037 WP_001177639.1.32049 WP_001177639.1.32063 WP_001177639.1.32078 WP_001177639.1.32091 WP_001177639.1.32093 WP_001177639.1.32121 WP_001177639.1.32127 WP_001177639.1.32138 WP_001177639.1.32142 WP_001177639.1.32143 WP_001177639.1.32173 WP_001177639.1.32184 WP_001177639.1.322 WP_001177639.1.32222 WP_001177639.1.32225 WP_001177639.1.32242 WP_001177639.1.32279 WP_001177639.1.32287 WP_001177639.1.3233 WP_001177639.1.32333 WP_001177639.1.32406 WP_001177639.1.32432 WP_001177639.1.32435 WP_001177639.1.32443 WP_001177639.1.32448 WP_001177639.1.3247 WP_001177639.1.32475 WP_001177639.1.32478 WP_001177639.1.32479 WP_001177639.1.3248 WP_001177639.1.32480 WP_001177639.1.32509 WP_001177639.1.32518 WP_001177639.1.32558 WP_001177639.1.32574 WP_001177639.1.32580 WP_001177639.1.3259 WP_001177639.1.32591 WP_001177639.1.32635 WP_001177639.1.32650 WP_001177639.1.32655 WP_001177639.1.32676 WP_001177639.1.3269 WP_001177639.1.327 WP_001177639.1.32709 WP_001177639.1.32715 WP_001177639.1.32718 WP_001177639.1.32720 WP_001177639.1.32741 WP_001177639.1.32748 WP_001177639.1.32772 WP_001177639.1.32815 WP_001177639.1.32831 WP_001177639.1.32835 WP_001177639.1.32875 WP_001177639.1.32888 WP_001177639.1.32903 WP_001177639.1.32938 WP_001177639.1.3295 WP_001177639.1.32959 WP_001177639.1.32984 WP_001177639.1.32995 WP_001177639.1.33004 WP_001177639.1.33026 WP_001177639.1.33046 WP_001177639.1.33049 WP_001177639.1.33053 WP_001177639.1.33055 WP_001177639.1.33094 WP_001177639.1.33101 WP_001177639.1.33125 WP_001177639.1.33167 WP_001177639.1.33171 WP_001177639.1.33178 WP_001177639.1.33179 WP_001177639.1.33190 WP_001177639.1.33217 WP_001177639.1.33222 WP_001177639.1.3323 WP_001177639.1.33237 WP_001177639.1.33244 WP_001177639.1.33268 WP_001177639.1.33303 WP_001177639.1.33325 WP_001177639.1.33341 WP_001177639.1.33352 WP_001177639.1.33362 WP_001177639.1.33369 WP_001177639.1.33385 WP_001177639.1.334 WP_001177639.1.33408 WP_001177639.1.33410 WP_001177639.1.33413 WP_001177639.1.33424 WP_001177639.1.33428 WP_001177639.1.3344 WP_001177639.1.33475 WP_001177639.1.33476 WP_001177639.1.33502 WP_001177639.1.33512 WP_001177639.1.33525 WP_001177639.1.3354 WP_001177639.1.33545 WP_001177639.1.33561 WP_001177639.1.33563 WP_001177639.1.33565 WP_001177639.1.33584 WP_001177639.1.33631 WP_001177639.1.33680 WP_001177639.1.33729 WP_001177639.1.33746 WP_001177639.1.33780 WP_001177639.1.33799 WP_001177639.1.33823 WP_001177639.1.33888 WP_001177639.1.33905 WP_001177639.1.33914 WP_001177639.1.33948 WP_001177639.1.33952 WP_001177639.1.33974 WP_001177639.1.33979 WP_001177639.1.33981 WP_001177639.1.34003 WP_001177639.1.3401 WP_001177639.1.3411 WP_001177639.1.34117 WP_001177639.1.34121 WP_001177639.1.34124 WP_001177639.1.34130 WP_001177639.1.34144 WP_001177639.1.3415 WP_001177639.1.342 WP_001177639.1.34204 WP_001177639.1.34206 WP_001177639.1.34208 WP_001177639.1.34224 WP_001177639.1.34270 WP_001177639.1.34273 WP_001177639.1.34294 WP_001177639.1.34303 WP_001177639.1.3432 WP_001177639.1.34341 WP_001177639.1.34348 WP_001177639.1.34362 WP_001177639.1.34363 WP_001177639.1.34380 WP_001177639.1.3439 WP_001177639.1.34397 WP_001177639.1.34400 WP_001177639.1.34422 WP_001177639.1.34440 WP_001177639.1.34441 WP_001177639.1.34444 WP_001177639.1.34456 WP_001177639.1.34470 WP_001177639.1.34500 WP_001177639.1.34525 WP_001177639.1.34528 WP_001177639.1.34532 WP_001177639.1.34538 WP_001177639.1.34541 WP_001177639.1.34557 WP_001177639.1.34558 WP_001177639.1.3460 WP_001177639.1.34617 WP_001177639.1.34655 WP_001177639.1.34668 WP_001177639.1.34675 WP_001177639.1.34680 WP_001177639.1.34683 WP_001177639.1.34686 WP_001177639.1.347 WP_001177639.1.3472 WP_001177639.1.34727 WP_001177639.1.34763 WP_001177639.1.34781 WP_001177639.1.34827 WP_001177639.1.34835 WP_001177639.1.34838 WP_001177639.1.34875 WP_001177639.1.34887 WP_001177639.1.34913 WP_001177639.1.34931 WP_001177639.1.34966 WP_001177639.1.34982 WP_001177639.1.34983 WP_001177639.1.34990 WP_001177639.1.34993 WP_001177639.1.35003 WP_001177639.1.35007 WP_001177639.1.35012 WP_001177639.1.35039 WP_001177639.1.35107 WP_001177639.1.35114 WP_001177639.1.35127 WP_001177639.1.35132 WP_001177639.1.3515 WP_001177639.1.35168 WP_001177639.1.35180 WP_001177639.1.35186 WP_001177639.1.35198 WP_001177639.1.35204 WP_001177639.1.35208 WP_001177639.1.3521 WP_001177639.1.35211 WP_001177639.1.35220 WP_001177639.1.35253 WP_001177639.1.35258 WP_001177639.1.35316 WP_001177639.1.35328 WP_001177639.1.35349 WP_001177639.1.35360 WP_001177639.1.35365 WP_001177639.1.35368 WP_001177639.1.35376 WP_001177639.1.3539 WP_001177639.1.35393 WP_001177639.1.35394 WP_001177639.1.35398 WP_001177639.1.35448 WP_001177639.1.35464 WP_001177639.1.35465 WP_001177639.1.35466 WP_001177639.1.35468 WP_001177639.1.3550 WP_001177639.1.35552 WP_001177639.1.35578 WP_001177639.1.35627 WP_001177639.1.35632 WP_001177639.1.35649 WP_001177639.1.35651 WP_001177639.1.35653 WP_001177639.1.35654 WP_001177639.1.35698 WP_001177639.1.35724 WP_001177639.1.35741 WP_001177639.1.35744 WP_001177639.1.35789 WP_001177639.1.35889 WP_001177639.1.35927 WP_001177639.1.35934 WP_001177639.1.35942 WP_001177639.1.35959 WP_001177639.1.35963 WP_001177639.1.35983 WP_001177639.1.35985 WP_001177639.1.35987 WP_001177639.1.35990 WP_001177639.1.3600 WP_001177639.1.36040 WP_001177639.1.36042 WP_001177639.1.36070 WP_001177639.1.36094 WP_001177639.1.36105 WP_001177639.1.36129 WP_001177639.1.36132 WP_001177639.1.36158 WP_001177639.1.36159 WP_001177639.1.36164 WP_001177639.1.36166 WP_001177639.1.36177 WP_001177639.1.3620 WP_001177639.1.36207 WP_001177639.1.36212 WP_001177639.1.3624 WP_001177639.1.36281 WP_001177639.1.36299 WP_001177639.1.36334 WP_001177639.1.36352 WP_001177639.1.36386 WP_001177639.1.36405 WP_001177639.1.36414 WP_001177639.1.36426 WP_001177639.1.3643 WP_001177639.1.36453 WP_001177639.1.36459 WP_001177639.1.36496 WP_001177639.1.365 WP_001177639.1.36507 WP_001177639.1.36531 WP_001177639.1.36537 WP_001177639.1.36545 WP_001177639.1.36610 WP_001177639.1.36626 WP_001177639.1.36667 WP_001177639.1.3668 WP_001177639.1.36699 WP_001177639.1.36707 WP_001177639.1.3671 WP_001177639.1.36724 WP_001177639.1.36746 WP_001177639.1.36761 WP_001177639.1.36767 WP_001177639.1.36786 WP_001177639.1.36799 WP_001177639.1.36806 WP_001177639.1.36812 WP_001177639.1.36833 WP_001177639.1.36856 WP_001177639.1.36886 WP_001177639.1.36894 WP_001177639.1.36904 WP_001177639.1.36925 WP_001177639.1.3697 WP_001177639.1.36971 WP_001177639.1.36975 WP_001177639.1.37006 WP_001177639.1.37020 WP_001177639.1.37032 WP_001177639.1.37046 WP_001177639.1.37049 WP_001177639.1.37057 WP_001177639.1.37076 WP_001177639.1.37099 WP_001177639.1.37101 WP_001177639.1.37103 WP_001177639.1.37146 WP_001177639.1.37153 WP_001177639.1.37155 WP_001177639.1.37206 WP_001177639.1.37226 WP_001177639.1.3723 WP_001177639.1.37233 WP_001177639.1.37261 WP_001177639.1.37266 WP_001177639.1.37290 WP_001177639.1.3730 WP_001177639.1.37306 WP_001177639.1.37312 WP_001177639.1.37313 WP_001177639.1.37334 WP_001177639.1.37337 WP_001177639.1.37342 WP_001177639.1.37352 WP_001177639.1.37360 WP_001177639.1.37371 WP_001177639.1.37372 WP_001177639.1.37388 WP_001177639.1.37419 WP_001177639.1.37423 WP_001177639.1.37433 WP_001177639.1.37445 WP_001177639.1.37472 WP_001177639.1.37476 WP_001177639.1.37477 WP_001177639.1.3749 WP_001177639.1.37510 WP_001177639.1.37516 WP_001177639.1.37538 WP_001177639.1.37543 WP_001177639.1.37544 WP_001177639.1.37548 WP_001177639.1.37549 WP_001177639.1.37550 WP_001177639.1.37576 WP_001177639.1.37588 WP_001177639.1.37592 WP_001177639.1.37608 WP_001177639.1.3762 WP_001177639.1.37637 WP_001177639.1.37664 WP_001177639.1.377 WP_001177639.1.3772 WP_001177639.1.37730 WP_001177639.1.37731 WP_001177639.1.37736 WP_001177639.1.37758 WP_001177639.1.37766 WP_001177639.1.37769 WP_001177639.1.37773 WP_001177639.1.37847 WP_001177639.1.37852 WP_001177639.1.37853 WP_001177639.1.3788 WP_001177639.1.37880 WP_001177639.1.37887 WP_001177639.1.37897 WP_001177639.1.37917 WP_001177639.1.37923 WP_001177639.1.37926 WP_001177639.1.37940 WP_001177639.1.3795 WP_001177639.1.3796 WP_001177639.1.37962 WP_001177639.1.37964 WP_001177639.1.37984 WP_001177639.1.37995 WP_001177639.1.37998 WP_001177639.1.38000 WP_001177639.1.38033 WP_001177639.1.38043 WP_001177639.1.38080 WP_001177639.1.38081 WP_001177639.1.38085 WP_001177639.1.38103 WP_001177639.1.38105 WP_001177639.1.38107 WP_001177639.1.3811 WP_001177639.1.38119 WP_001177639.1.38120 WP_001177639.1.38162 WP_001177639.1.38182 WP_001177639.1.38185 WP_001177639.1.38194 WP_001177639.1.38202 WP_001177639.1.3822 WP_001177639.1.38234 WP_001177639.1.38257 WP_001177639.1.38264 WP_001177639.1.38293 WP_001177639.1.38300 WP_001177639.1.38306 WP_001177639.1.38323 WP_001177639.1.38369 WP_001177639.1.38371 WP_001177639.1.38392 WP_001177639.1.38412 WP_001177639.1.38419 WP_001177639.1.38533 WP_001177639.1.38561 WP_001177639.1.38567 WP_001177639.1.38610 WP_001177639.1.38626 WP_001177639.1.38629 WP_001177639.1.38636 WP_001177639.1.38751 WP_001177639.1.38777 WP_001177639.1.38782 WP_001177639.1.38811 WP_001177639.1.38827 WP_001177639.1.38835 WP_001177639.1.389 WP_001177639.1.38911 WP_001177639.1.38920 WP_001177639.1.38937 WP_001177639.1.38950 WP_001177639.1.38956 WP_001177639.1.39005 WP_001177639.1.39015 WP_001177639.1.3903 WP_001177639.1.39037 WP_001177639.1.39042 WP_001177639.1.39063 WP_001177639.1.39103 WP_001177639.1.39111 WP_001177639.1.39123 WP_001177639.1.39148 WP_001177639.1.39155 WP_001177639.1.39157 WP_001177639.1.39164 WP_001177639.1.39171 WP_001177639.1.39180 WP_001177639.1.39184 WP_001177639.1.39196 WP_001177639.1.39209 WP_001177639.1.3921 WP_001177639.1.3922 WP_001177639.1.39254 WP_001177639.1.39268 WP_001177639.1.39289 WP_001177639.1.39302 WP_001177639.1.39310 WP_001177639.1.39313 WP_001177639.1.39325 WP_001177639.1.39327 WP_001177639.1.39335 WP_001177639.1.39356 WP_001177639.1.39358 WP_001177639.1.39365 WP_001177639.1.39367 WP_001177639.1.39373 WP_001177639.1.39377 WP_001177639.1.39401 WP_001177639.1.39402 WP_001177639.1.39415 WP_001177639.1.39423 WP_001177639.1.39430 WP_001177639.1.39468 WP_001177639.1.39481 WP_001177639.1.39492 WP_001177639.1.39509 WP_001177639.1.39531 WP_001177639.1.39541 WP_001177639.1.39575 WP_001177639.1.39580 WP_001177639.1.39601 WP_001177639.1.39606 WP_001177639.1.39626 WP_001177639.1.39636 WP_001177639.1.39646 WP_001177639.1.39651 WP_001177639.1.39690 WP_001177639.1.3970 WP_001177639.1.39708 WP_001177639.1.39713 WP_001177639.1.39715 WP_001177639.1.39717 WP_001177639.1.39726 WP_001177639.1.39730 WP_001177639.1.39733 WP_001177639.1.39734 WP_001177639.1.39780 WP_001177639.1.39796 WP_001177639.1.39809 WP_001177639.1.39818 WP_001177639.1.39820 WP_001177639.1.39829 WP_001177639.1.39867 WP_001177639.1.39870 WP_001177639.1.39892 WP_001177639.1.39938 WP_001177639.1.39961 WP_001177639.1.39973 WP_001177639.1.40 WP_001177639.1.40013 WP_001177639.1.40016 WP_001177639.1.40019 WP_001177639.1.4005 WP_001177639.1.40083 WP_001177639.1.40088 WP_001177639.1.40107 WP_001177639.1.40121 WP_001177639.1.40140 WP_001177639.1.40147 WP_001177639.1.40153 WP_001177639.1.40159 WP_001177639.1.40183 WP_001177639.1.40190 WP_001177639.1.40192 WP_001177639.1.4020 WP_001177639.1.40206 WP_001177639.1.40211 WP_001177639.1.40212 WP_001177639.1.40218 WP_001177639.1.40234 WP_001177639.1.40249 WP_001177639.1.40298 WP_001177639.1.4030 WP_001177639.1.40300 WP_001177639.1.40317 WP_001177639.1.40345 WP_001177639.1.40349 WP_001177639.1.40360 WP_001177639.1.40382 WP_001177639.1.40389 WP_001177639.1.40391 WP_001177639.1.40403 WP_001177639.1.40445 WP_001177639.1.40486 WP_001177639.1.4049 WP_001177639.1.40499 WP_001177639.1.40509 WP_001177639.1.40524 WP_001177639.1.40539 WP_001177639.1.40548 WP_001177639.1.40549 WP_001177639.1.40560 WP_001177639.1.40563 WP_001177639.1.406 WP_001177639.1.40607 WP_001177639.1.40623 WP_001177639.1.40629 WP_001177639.1.40636 WP_001177639.1.40657 WP_001177639.1.40660 WP_001177639.1.40666 WP_001177639.1.40668 WP_001177639.1.40686 WP_001177639.1.40715 WP_001177639.1.40742 WP_001177639.1.40781 WP_001177639.1.4081 WP_001177639.1.40813 WP_001177639.1.40815 WP_001177639.1.4082 WP_001177639.1.40842 WP_001177639.1.40843 WP_001177639.1.40893 WP_001177639.1.40898 WP_001177639.1.40900 WP_001177639.1.40912 WP_001177639.1.40937 WP_001177639.1.40952 WP_001177639.1.40965 WP_001177639.1.4103 WP_001177639.1.41041 WP_001177639.1.41045 WP_001177639.1.41060 WP_001177639.1.41063 WP_001177639.1.41078 WP_001177639.1.41113 WP_001177639.1.41125 WP_001177639.1.41206 WP_001177639.1.4122 WP_001177639.1.41230 WP_001177639.1.41239 WP_001177639.1.41244 WP_001177639.1.41259 WP_001177639.1.4126 WP_001177639.1.41263 WP_001177639.1.41287 WP_001177639.1.41294 WP_001177639.1.41332 WP_001177639.1.41339 WP_001177639.1.41363 WP_001177639.1.41368 WP_001177639.1.41371 WP_001177639.1.41372 WP_001177639.1.41391 WP_001177639.1.41392 WP_001177639.1.41394 WP_001177639.1.41401 WP_001177639.1.41402 WP_001177639.1.4142 WP_001177639.1.41436 WP_001177639.1.41449 WP_001177639.1.41453 WP_001177639.1.41455 WP_001177639.1.41457 WP_001177639.1.41466 WP_001177639.1.41479 WP_001177639.1.41481 WP_001177639.1.41482 WP_001177639.1.41483 WP_001177639.1.41484 WP_001177639.1.41488 WP_001177639.1.41513 WP_001177639.1.41530 WP_001177639.1.41536 WP_001177639.1.41539 WP_001177639.1.41545 WP_001177639.1.41556 WP_001177639.1.4158 WP_001177639.1.41606 WP_001177639.1.41613 WP_001177639.1.41621 WP_001177639.1.41651 WP_001177639.1.41712 WP_001177639.1.41718 WP_001177639.1.4172 WP_001177639.1.41734 WP_001177639.1.41740 WP_001177639.1.41741 WP_001177639.1.41752 WP_001177639.1.41778 WP_001177639.1.41780 WP_001177639.1.41782 WP_001177639.1.41783 WP_001177639.1.41784 WP_001177639.1.41809 WP_001177639.1.41812 WP_001177639.1.41813 WP_001177639.1.41822 WP_001177639.1.41837 WP_001177639.1.41849 WP_001177639.1.41884 WP_001177639.1.41885 WP_001177639.1.4189 WP_001177639.1.41900 WP_001177639.1.41923 WP_001177639.1.4193 WP_001177639.1.41956 WP_001177639.1.41964 WP_001177639.1.41990 WP_001177639.1.41991 WP_001177639.1.42022 WP_001177639.1.42027 WP_001177639.1.42033 WP_001177639.1.42038 WP_001177639.1.42044 WP_001177639.1.42060 WP_001177639.1.42073 WP_001177639.1.42095 WP_001177639.1.42096 WP_001177639.1.4213 WP_001177639.1.42138 WP_001177639.1.4214 WP_001177639.1.42151 WP_001177639.1.42159 WP_001177639.1.42179 WP_001177639.1.42191 WP_001177639.1.42203 WP_001177639.1.42209 WP_001177639.1.42221 WP_001177639.1.42226 WP_001177639.1.42228 WP_001177639.1.42252 WP_001177639.1.42258 WP_001177639.1.42277 WP_001177639.1.42284 WP_001177639.1.42300 WP_001177639.1.42350 WP_001177639.1.42359 WP_001177639.1.42369 WP_001177639.1.42376 WP_001177639.1.42387 WP_001177639.1.42413 WP_001177639.1.42415 WP_001177639.1.4242 WP_001177639.1.42432 WP_001177639.1.42442 WP_001177639.1.42443 WP_001177639.1.42447 WP_001177639.1.42448 WP_001177639.1.42456 WP_001177639.1.42480 WP_001177639.1.4250 WP_001177639.1.42516 WP_001177639.1.42586 WP_001177639.1.42597 WP_001177639.1.42600 WP_001177639.1.42601 WP_001177639.1.42632 WP_001177639.1.42638 WP_001177639.1.42669 WP_001177639.1.42670 WP_001177639.1.42677 WP_001177639.1.42709 WP_001177639.1.42728 WP_001177639.1.42748 WP_001177639.1.42750 WP_001177639.1.42761 WP_001177639.1.42770 WP_001177639.1.42771 WP_001177639.1.42791 WP_001177639.1.42804 WP_001177639.1.42808 WP_001177639.1.42813 WP_001177639.1.4282 WP_001177639.1.42828 WP_001177639.1.42830 WP_001177639.1.42832 WP_001177639.1.42863 WP_001177639.1.42879 WP_001177639.1.42880 WP_001177639.1.42918 WP_001177639.1.42936 WP_001177639.1.42937 WP_001177639.1.42950 WP_001177639.1.42962 WP_001177639.1.42966 WP_001177639.1.42970 WP_001177639.1.42975 WP_001177639.1.42987 WP_001177639.1.42989 WP_001177639.1.42991 WP_001177639.1.43013 WP_001177639.1.43027 WP_001177639.1.4306 WP_001177639.1.43079 WP_001177639.1.43121 WP_001177639.1.43123 WP_001177639.1.43132 WP_001177639.1.43137 WP_001177639.1.43166 WP_001177639.1.43170 WP_001177639.1.43174 WP_001177639.1.43177 WP_001177639.1.43213 WP_001177639.1.43216 WP_001177639.1.43270 WP_001177639.1.43278 WP_001177639.1.43316 WP_001177639.1.43324 WP_001177639.1.4334 WP_001177639.1.43363 WP_001177639.1.43374 WP_001177639.1.43384 WP_001177639.1.4342 WP_001177639.1.43422 WP_001177639.1.43427 WP_001177639.1.4343 WP_001177639.1.43455 WP_001177639.1.43469 WP_001177639.1.43473 WP_001177639.1.43489 WP_001177639.1.43501 WP_001177639.1.43536 WP_001177639.1.4356 WP_001177639.1.43561 WP_001177639.1.43566 WP_001177639.1.43598 WP_001177639.1.436 WP_001177639.1.43604 WP_001177639.1.43622 WP_001177639.1.43642 WP_001177639.1.43720 WP_001177639.1.43733 WP_001177639.1.43738 WP_001177639.1.43754 WP_001177639.1.43769 WP_001177639.1.43798 WP_001177639.1.43803 WP_001177639.1.43804 WP_001177639.1.43816 WP_001177639.1.43837 WP_001177639.1.43868 WP_001177639.1.43898 WP_001177639.1.43911 WP_001177639.1.43918 WP_001177639.1.43925 WP_001177639.1.43939 WP_001177639.1.43942 WP_001177639.1.43953 WP_001177639.1.43966 WP_001177639.1.43989 WP_001177639.1.440 WP_001177639.1.4400 WP_001177639.1.44018 WP_001177639.1.44029 WP_001177639.1.44040 WP_001177639.1.44077 WP_001177639.1.44088 WP_001177639.1.44096 WP_001177639.1.44100 WP_001177639.1.4411 WP_001177639.1.44115 WP_001177639.1.44130 WP_001177639.1.44133 WP_001177639.1.4415 WP_001177639.1.44162 WP_001177639.1.44165 WP_001177639.1.44166 WP_001177639.1.44203 WP_001177639.1.44211 WP_001177639.1.44222 WP_001177639.1.44238 WP_001177639.1.44251 WP_001177639.1.44263 WP_001177639.1.44264 WP_001177639.1.44285 WP_001177639.1.44287 WP_001177639.1.44292 WP_001177639.1.44314 WP_001177639.1.44324 WP_001177639.1.44327 WP_001177639.1.44354 WP_001177639.1.44365 WP_001177639.1.44389 WP_001177639.1.44394 WP_001177639.1.44422 WP_001177639.1.44424 WP_001177639.1.44426 WP_001177639.1.44447 WP_001177639.1.4445 WP_001177639.1.44452 WP_001177639.1.44458 WP_001177639.1.44460 WP_001177639.1.44488 WP_001177639.1.4449 WP_001177639.1.44539 WP_001177639.1.4454 WP_001177639.1.44558 WP_001177639.1.44561 WP_001177639.1.44570 WP_001177639.1.4459 WP_001177639.1.44622 WP_001177639.1.44627 WP_001177639.1.4463 WP_001177639.1.44642 WP_001177639.1.44649 WP_001177639.1.44668 WP_001177639.1.44671 WP_001177639.1.44686 WP_001177639.1.4471 WP_001177639.1.44717 WP_001177639.1.44724 WP_001177639.1.4473 WP_001177639.1.44733 WP_001177639.1.44759 WP_001177639.1.44784 WP_001177639.1.448 WP_001177639.1.44800 WP_001177639.1.44814 WP_001177639.1.44818 WP_001177639.1.44821 WP_001177639.1.44836 WP_001177639.1.44840 WP_001177639.1.44843 WP_001177639.1.44848 WP_001177639.1.44849 WP_001177639.1.44854 WP_001177639.1.44857 WP_001177639.1.44906 WP_001177639.1.44923 WP_001177639.1.44954 WP_001177639.1.44960 WP_001177639.1.44961 WP_001177639.1.44970 WP_001177639.1.44975 WP_001177639.1.44980 WP_001177639.1.45000 WP_001177639.1.45020 WP_001177639.1.45043 WP_001177639.1.45068 WP_001177639.1.45076 WP_001177639.1.45104 WP_001177639.1.4515 WP_001177639.1.45153 WP_001177639.1.45156 WP_001177639.1.4516 WP_001177639.1.45190 WP_001177639.1.45208 WP_001177639.1.4524 WP_001177639.1.45246 WP_001177639.1.45293 WP_001177639.1.4530 WP_001177639.1.45301 WP_001177639.1.45313 WP_001177639.1.45329 WP_001177639.1.4535 WP_001177639.1.4538 WP_001177639.1.45392 WP_001177639.1.45404 WP_001177639.1.45405 WP_001177639.1.4541 WP_001177639.1.45486 WP_001177639.1.4549 WP_001177639.1.45494 WP_001177639.1.45500 WP_001177639.1.45525 WP_001177639.1.45536 WP_001177639.1.45538 WP_001177639.1.45565 WP_001177639.1.45575 WP_001177639.1.45581 WP_001177639.1.45595 WP_001177639.1.45600 WP_001177639.1.45627 WP_001177639.1.4563 WP_001177639.1.45664 WP_001177639.1.45674 WP_001177639.1.45676 WP_001177639.1.45707 WP_001177639.1.45718 WP_001177639.1.4574 WP_001177639.1.45740 WP_001177639.1.45741 WP_001177639.1.45752 WP_001177639.1.4576 WP_001177639.1.45789 WP_001177639.1.45793 WP_001177639.1.45799 WP_001177639.1.45801 WP_001177639.1.45806 WP_001177639.1.4583 WP_001177639.1.45840 WP_001177639.1.45841 WP_001177639.1.45846 WP_001177639.1.45865 WP_001177639.1.45868 WP_001177639.1.45891 WP_001177639.1.45921 WP_001177639.1.4593 WP_001177639.1.45930 WP_001177639.1.45931 WP_001177639.1.45933 WP_001177639.1.45941 WP_001177639.1.45949 WP_001177639.1.45960 WP_001177639.1.45962 WP_001177639.1.45968 WP_001177639.1.45990 WP_001177639.1.45991 WP_001177639.1.4600 WP_001177639.1.46016 WP_001177639.1.46027 WP_001177639.1.46039 WP_001177639.1.46048 WP_001177639.1.46081 WP_001177639.1.4610 WP_001177639.1.46105 WP_001177639.1.46115 WP_001177639.1.46122 WP_001177639.1.46164 WP_001177639.1.4617 WP_001177639.1.46186 WP_001177639.1.4619 WP_001177639.1.46197 WP_001177639.1.46213 WP_001177639.1.46239 WP_001177639.1.46245 WP_001177639.1.46263 WP_001177639.1.46283 WP_001177639.1.46291 WP_001177639.1.46301 WP_001177639.1.46325 WP_001177639.1.46329 WP_001177639.1.46369 WP_001177639.1.46378 WP_001177639.1.46379 WP_001177639.1.46414 WP_001177639.1.46429 WP_001177639.1.4643 WP_001177639.1.46433 WP_001177639.1.46438 WP_001177639.1.46441 WP_001177639.1.46451 WP_001177639.1.46468 WP_001177639.1.4647 WP_001177639.1.46526 WP_001177639.1.46531 WP_001177639.1.46541 WP_001177639.1.46555 WP_001177639.1.4657 WP_001177639.1.46582 WP_001177639.1.46589 WP_001177639.1.46594 WP_001177639.1.46597 WP_001177639.1.46602 WP_001177639.1.46616 WP_001177639.1.46626 WP_001177639.1.46643 WP_001177639.1.46655 WP_001177639.1.46668 WP_001177639.1.4670 WP_001177639.1.46734 WP_001177639.1.46743 WP_001177639.1.46795 WP_001177639.1.46798 WP_001177639.1.46802 WP_001177639.1.46806 WP_001177639.1.46810 WP_001177639.1.46821 WP_001177639.1.46832 WP_001177639.1.46833 WP_001177639.1.46841 WP_001177639.1.46857 WP_001177639.1.46860 WP_001177639.1.46876 WP_001177639.1.46898 WP_001177639.1.46909 WP_001177639.1.4691 WP_001177639.1.4695 WP_001177639.1.46991 WP_001177639.1.46994 WP_001177639.1.46999 WP_001177639.1.47024 WP_001177639.1.47028 WP_001177639.1.47030 WP_001177639.1.47034 WP_001177639.1.47038 WP_001177639.1.47039 WP_001177639.1.47047 WP_001177639.1.47048 WP_001177639.1.47050 WP_001177639.1.47054 WP_001177639.1.47063 WP_001177639.1.47073 WP_001177639.1.4708 WP_001177639.1.47124 WP_001177639.1.47135 WP_001177639.1.47140 WP_001177639.1.47156 WP_001177639.1.47167 WP_001177639.1.47171 WP_001177639.1.47189 WP_001177639.1.47197 WP_001177639.1.4723 WP_001177639.1.47235 WP_001177639.1.47246 WP_001177639.1.47247 WP_001177639.1.4725 WP_001177639.1.47316 WP_001177639.1.47322 WP_001177639.1.47344 WP_001177639.1.47349 WP_001177639.1.47350 WP_001177639.1.47363 WP_001177639.1.47366 WP_001177639.1.47398 WP_001177639.1.47414 WP_001177639.1.47416 WP_001177639.1.47425 WP_001177639.1.4743 WP_001177639.1.47451 WP_001177639.1.47454 WP_001177639.1.47464 WP_001177639.1.47473 WP_001177639.1.47477 WP_001177639.1.47488 WP_001177639.1.47496 WP_001177639.1.47498 WP_001177639.1.47500 WP_001177639.1.47529 WP_001177639.1.47533 WP_001177639.1.47546 WP_001177639.1.47582 WP_001177639.1.47599 WP_001177639.1.47634 WP_001177639.1.47647 WP_001177639.1.47654 WP_001177639.1.47662 WP_001177639.1.47673 WP_001177639.1.47709 WP_001177639.1.4772 WP_001177639.1.47722 WP_001177639.1.4773 WP_001177639.1.47734 WP_001177639.1.47744 WP_001177639.1.47765 WP_001177639.1.47775 WP_001177639.1.47784 WP_001177639.1.47790 WP_001177639.1.47791 WP_001177639.1.47820 WP_001177639.1.47827 WP_001177639.1.4783 WP_001177639.1.47837 WP_001177639.1.47848 WP_001177639.1.4785 WP_001177639.1.47884 WP_001177639.1.47914 WP_001177639.1.47935 WP_001177639.1.4796 WP_001177639.1.47962 WP_001177639.1.47976 WP_001177639.1.47981 WP_001177639.1.47983 WP_001177639.1.47994 WP_001177639.1.48000 WP_001177639.1.48018 WP_001177639.1.48029 WP_001177639.1.48040 WP_001177639.1.48051 WP_001177639.1.48065 WP_001177639.1.48077 WP_001177639.1.48087 WP_001177639.1.48090 WP_001177639.1.48096 WP_001177639.1.4811 WP_001177639.1.48111 WP_001177639.1.48121 WP_001177639.1.48144 WP_001177639.1.48168 WP_001177639.1.48176 WP_001177639.1.48194 WP_001177639.1.48200 WP_001177639.1.48216 WP_001177639.1.48222 WP_001177639.1.48226 WP_001177639.1.48229 WP_001177639.1.48258 WP_001177639.1.4826 WP_001177639.1.48265 WP_001177639.1.48285 WP_001177639.1.48290 WP_001177639.1.48317 WP_001177639.1.48353 WP_001177639.1.48355 WP_001177639.1.48404 WP_001177639.1.48417 WP_001177639.1.48421 WP_001177639.1.48431 WP_001177639.1.48433 WP_001177639.1.48469 WP_001177639.1.48477 WP_001177639.1.48480 WP_001177639.1.48505 WP_001177639.1.48522 WP_001177639.1.4857 WP_001177639.1.48571 WP_001177639.1.48590 WP_001177639.1.486 WP_001177639.1.48602 WP_001177639.1.48615 WP_001177639.1.48620 WP_001177639.1.48626 WP_001177639.1.48629 WP_001177639.1.48678 WP_001177639.1.48689 WP_001177639.1.48697 WP_001177639.1.4871 WP_001177639.1.48712 WP_001177639.1.4876 WP_001177639.1.48771 WP_001177639.1.48801 WP_001177639.1.48806 WP_001177639.1.48808 WP_001177639.1.48825 WP_001177639.1.48827 WP_001177639.1.48860 WP_001177639.1.48902 WP_001177639.1.48907 WP_001177639.1.48910 WP_001177639.1.4892 WP_001177639.1.48921 WP_001177639.1.48926 WP_001177639.1.48953 WP_001177639.1.48954 WP_001177639.1.48974 WP_001177639.1.49001 WP_001177639.1.49009 WP_001177639.1.49061 WP_001177639.1.49076 WP_001177639.1.49107 WP_001177639.1.49124 WP_001177639.1.49136 WP_001177639.1.49141 WP_001177639.1.49170 WP_001177639.1.49179 WP_001177639.1.49229 WP_001177639.1.49236 WP_001177639.1.49243 WP_001177639.1.49258 WP_001177639.1.49259 WP_001177639.1.49275 WP_001177639.1.4931 WP_001177639.1.49321 WP_001177639.1.49332 WP_001177639.1.49336 WP_001177639.1.49338 WP_001177639.1.49342 WP_001177639.1.49347 WP_001177639.1.49363 WP_001177639.1.49376 WP_001177639.1.49401 WP_001177639.1.49412 WP_001177639.1.49431 WP_001177639.1.49446 WP_001177639.1.49481 WP_001177639.1.49482 WP_001177639.1.49483 WP_001177639.1.4949 WP_001177639.1.49496 WP_001177639.1.49521 WP_001177639.1.49522 WP_001177639.1.49528 WP_001177639.1.4953 WP_001177639.1.49531 WP_001177639.1.49537 WP_001177639.1.49546 WP_001177639.1.49558 WP_001177639.1.49567 WP_001177639.1.49594 WP_001177639.1.49599 WP_001177639.1.49615 WP_001177639.1.49625 WP_001177639.1.49645 WP_001177639.1.49655 WP_001177639.1.49661 WP_001177639.1.49662 WP_001177639.1.49675 WP_001177639.1.49684 WP_001177639.1.49712 WP_001177639.1.49722 WP_001177639.1.49733 WP_001177639.1.49747 WP_001177639.1.49768 WP_001177639.1.49771 WP_001177639.1.49774 WP_001177639.1.49777 WP_001177639.1.49783 WP_001177639.1.49788 WP_001177639.1.49794 WP_001177639.1.49820 WP_001177639.1.49823 WP_001177639.1.4985 WP_001177639.1.49856 WP_001177639.1.49861 WP_001177639.1.49879 WP_001177639.1.49884 WP_001177639.1.49900 WP_001177639.1.49902 WP_001177639.1.49941 WP_001177639.1.49950 WP_001177639.1.49954 WP_001177639.1.49972 WP_001177639.1.50006 WP_001177639.1.50008 WP_001177639.1.5003 WP_001177639.1.50036 WP_001177639.1.50056 WP_001177639.1.50058 WP_001177639.1.50078 WP_001177639.1.50098 WP_001177639.1.50110 WP_001177639.1.50113 WP_001177639.1.50119 WP_001177639.1.50136 WP_001177639.1.50146 WP_001177639.1.50179 WP_001177639.1.50182 WP_001177639.1.50187 WP_001177639.1.50191 WP_001177639.1.50196 WP_001177639.1.50207 WP_001177639.1.50214 WP_001177639.1.50228 WP_001177639.1.50230 WP_001177639.1.50258 WP_001177639.1.50262 WP_001177639.1.50266 WP_001177639.1.50270 WP_001177639.1.50273 WP_001177639.1.50278 WP_001177639.1.50304 WP_001177639.1.50329 WP_001177639.1.50345 WP_001177639.1.50361 WP_001177639.1.50366 WP_001177639.1.5037 WP_001177639.1.50380 WP_001177639.1.50381 WP_001177639.1.5040 WP_001177639.1.5041 WP_001177639.1.50412 WP_001177639.1.50418 WP_001177639.1.50427 WP_001177639.1.50446 WP_001177639.1.50452 WP_001177639.1.5046 WP_001177639.1.50539 WP_001177639.1.50548 WP_001177639.1.50549 WP_001177639.1.50585 WP_001177639.1.506 WP_001177639.1.50608 WP_001177639.1.5061 WP_001177639.1.50616 WP_001177639.1.50627 WP_001177639.1.5067 WP_001177639.1.50690 WP_001177639.1.50700 WP_001177639.1.50715 WP_001177639.1.50725 WP_001177639.1.50728 WP_001177639.1.50762 WP_001177639.1.50887 WP_001177639.1.50925 WP_001177639.1.50936 WP_001177639.1.50947 WP_001177639.1.50957 WP_001177639.1.50969 WP_001177639.1.50986 WP_001177639.1.50988 WP_001177639.1.50990 WP_001177639.1.50993 WP_001177639.1.50996 WP_001177639.1.51013 WP_001177639.1.51027 WP_001177639.1.51042 WP_001177639.1.5106 WP_001177639.1.511 WP_001177639.1.51109 WP_001177639.1.51127 WP_001177639.1.51170 WP_001177639.1.51171 WP_001177639.1.51172 WP_001177639.1.51175 WP_001177639.1.51180 WP_001177639.1.51190 WP_001177639.1.51201 WP_001177639.1.51203 WP_001177639.1.51206 WP_001177639.1.51211 WP_001177639.1.5124 WP_001177639.1.51248 WP_001177639.1.51260 WP_001177639.1.51278 WP_001177639.1.5128 WP_001177639.1.51283 WP_001177639.1.51299 WP_001177639.1.51320 WP_001177639.1.51330 WP_001177639.1.51336 WP_001177639.1.51354 WP_001177639.1.51360 WP_001177639.1.51364 WP_001177639.1.51392 WP_001177639.1.51405 WP_001177639.1.51426 WP_001177639.1.51427 WP_001177639.1.51482 WP_001177639.1.51490 WP_001177639.1.51495 WP_001177639.1.51503 WP_001177639.1.51505 WP_001177639.1.51513 WP_001177639.1.51537 WP_001177639.1.51539 WP_001177639.1.51542 WP_001177639.1.51552 WP_001177639.1.5157 WP_001177639.1.5158 WP_001177639.1.51580 WP_001177639.1.51587 WP_001177639.1.51596 WP_001177639.1.51600 WP_001177639.1.51607 WP_001177639.1.51624 WP_001177639.1.51629 WP_001177639.1.51643 WP_001177639.1.51662 WP_001177639.1.51690 WP_001177639.1.51693 WP_001177639.1.5172 WP_001177639.1.51736 WP_001177639.1.51757 WP_001177639.1.51760 WP_001177639.1.51784 WP_001177639.1.518 WP_001177639.1.51804 WP_001177639.1.51834 WP_001177639.1.51839 WP_001177639.1.51869 WP_001177639.1.51873 WP_001177639.1.51881 WP_001177639.1.51896 WP_001177639.1.51899 WP_001177639.1.51906 WP_001177639.1.51944 WP_001177639.1.51949 WP_001177639.1.51979 WP_001177639.1.51985 WP_001177639.1.51988 WP_001177639.1.5199 WP_001177639.1.51999 WP_001177639.1.52011 WP_001177639.1.52020 WP_001177639.1.52044 WP_001177639.1.52048 WP_001177639.1.52076 WP_001177639.1.52085 WP_001177639.1.52098 WP_001177639.1.52111 WP_001177639.1.52126 WP_001177639.1.52127 WP_001177639.1.52135 WP_001177639.1.52137 WP_001177639.1.5217 WP_001177639.1.52171 WP_001177639.1.52186 WP_001177639.1.52211 WP_001177639.1.52213 WP_001177639.1.52214 WP_001177639.1.52225 WP_001177639.1.52230 WP_001177639.1.52236 WP_001177639.1.52240 WP_001177639.1.52243 WP_001177639.1.52257 WP_001177639.1.52270 WP_001177639.1.52271 WP_001177639.1.52272 WP_001177639.1.52299 WP_001177639.1.52304 WP_001177639.1.52305 WP_001177639.1.52313 WP_001177639.1.52324 WP_001177639.1.52328 WP_001177639.1.52333 WP_001177639.1.52363 WP_001177639.1.52378 WP_001177639.1.52406 WP_001177639.1.52413 WP_001177639.1.52419 WP_001177639.1.52492 WP_001177639.1.52542 WP_001177639.1.52543 WP_001177639.1.52554 WP_001177639.1.52558 WP_001177639.1.52567 WP_001177639.1.52568 WP_001177639.1.52601 WP_001177639.1.52631 WP_001177639.1.5265 WP_001177639.1.52662 WP_001177639.1.52691 WP_001177639.1.52704 WP_001177639.1.52710 WP_001177639.1.5272 WP_001177639.1.52735 WP_001177639.1.52755 WP_001177639.1.52771 WP_001177639.1.52774 WP_001177639.1.52777 WP_001177639.1.52781 WP_001177639.1.52801 WP_001177639.1.52804 WP_001177639.1.52844 WP_001177639.1.5285 WP_001177639.1.52852 WP_001177639.1.52853 WP_001177639.1.52855 WP_001177639.1.52881 WP_001177639.1.52883 WP_001177639.1.52895 WP_001177639.1.52908 WP_001177639.1.5291 WP_001177639.1.52913 WP_001177639.1.52933 WP_001177639.1.52942 WP_001177639.1.52945 WP_001177639.1.52962 WP_001177639.1.52995 WP_001177639.1.52996 WP_001177639.1.53012 WP_001177639.1.53020 WP_001177639.1.53021 WP_001177639.1.53065 WP_001177639.1.53084 WP_001177639.1.53099 WP_001177639.1.5310 WP_001177639.1.53110 WP_001177639.1.53123 WP_001177639.1.53162 WP_001177639.1.53186 WP_001177639.1.532 WP_001177639.1.53211 WP_001177639.1.5322 WP_001177639.1.53242 WP_001177639.1.53244 WP_001177639.1.53251 WP_001177639.1.53252 WP_001177639.1.53270 WP_001177639.1.53277 WP_001177639.1.53308 WP_001177639.1.53327 WP_001177639.1.53356 WP_001177639.1.53360 WP_001177639.1.53364 WP_001177639.1.53377 WP_001177639.1.53401 WP_001177639.1.53410 WP_001177639.1.53415 WP_001177639.1.53419 WP_001177639.1.5342 WP_001177639.1.53428 WP_001177639.1.53431 WP_001177639.1.53505 WP_001177639.1.5351 WP_001177639.1.53535 WP_001177639.1.53537 WP_001177639.1.53545 WP_001177639.1.53556 WP_001177639.1.53557 WP_001177639.1.53574 WP_001177639.1.53582 WP_001177639.1.53587 WP_001177639.1.53589 WP_001177639.1.53590 WP_001177639.1.53592 WP_001177639.1.53594 WP_001177639.1.5362 WP_001177639.1.53642 WP_001177639.1.53645 WP_001177639.1.53649 WP_001177639.1.53687 WP_001177639.1.53690 WP_001177639.1.53693 WP_001177639.1.53706 WP_001177639.1.53769 WP_001177639.1.53811 WP_001177639.1.53841 WP_001177639.1.53866 WP_001177639.1.53878 WP_001177639.1.53884 WP_001177639.1.5391 WP_001177639.1.53931 WP_001177639.1.53940 WP_001177639.1.5395 WP_001177639.1.53966 WP_001177639.1.53968 WP_001177639.1.53972 WP_001177639.1.53991 WP_001177639.1.53994 WP_001177639.1.54002 WP_001177639.1.54013 WP_001177639.1.54023 WP_001177639.1.54024 WP_001177639.1.54028 WP_001177639.1.54032 WP_001177639.1.54051 WP_001177639.1.54072 WP_001177639.1.54091 WP_001177639.1.54095 WP_001177639.1.54102 WP_001177639.1.54104 WP_001177639.1.54185 WP_001177639.1.54188 WP_001177639.1.54208 WP_001177639.1.54213 WP_001177639.1.54307 WP_001177639.1.54313 WP_001177639.1.5433 WP_001177639.1.5434 WP_001177639.1.54359 WP_001177639.1.54388 WP_001177639.1.54394 WP_001177639.1.5440 WP_001177639.1.54411 WP_001177639.1.54417 WP_001177639.1.54418 WP_001177639.1.54429 WP_001177639.1.54439 WP_001177639.1.54454 WP_001177639.1.54463 WP_001177639.1.54507 WP_001177639.1.54524 WP_001177639.1.54534 WP_001177639.1.54590 WP_001177639.1.54591 WP_001177639.1.54601 WP_001177639.1.54602 WP_001177639.1.54605 WP_001177639.1.54614 WP_001177639.1.54617 WP_001177639.1.54620 WP_001177639.1.54638 WP_001177639.1.54641 WP_001177639.1.54643 WP_001177639.1.54688 WP_001177639.1.5470 WP_001177639.1.54708 WP_001177639.1.54725 WP_001177639.1.54729 WP_001177639.1.54754 WP_001177639.1.54755 WP_001177639.1.54760 WP_001177639.1.5478 WP_001177639.1.5486 WP_001177639.1.54875 WP_001177639.1.54921 WP_001177639.1.54927 WP_001177639.1.54940 WP_001177639.1.54946 WP_001177639.1.54972 WP_001177639.1.54981 WP_001177639.1.54989 WP_001177639.1.54993 WP_001177639.1.55003 WP_001177639.1.55005 WP_001177639.1.55009 WP_001177639.1.55041 WP_001177639.1.55070 WP_001177639.1.55112 WP_001177639.1.55115 WP_001177639.1.55123 WP_001177639.1.55144 WP_001177639.1.55149 WP_001177639.1.55151 WP_001177639.1.55177 WP_001177639.1.55179 WP_001177639.1.55185 WP_001177639.1.55197 WP_001177639.1.5520 WP_001177639.1.55203 WP_001177639.1.55273 WP_001177639.1.55275 WP_001177639.1.55286 WP_001177639.1.55291 WP_001177639.1.55338 WP_001177639.1.55342 WP_001177639.1.55357 WP_001177639.1.55359 WP_001177639.1.55374 WP_001177639.1.55417 WP_001177639.1.55420 WP_001177639.1.55425 WP_001177639.1.55466 WP_001177639.1.55472 WP_001177639.1.55482 WP_001177639.1.55483 WP_001177639.1.55492 WP_001177639.1.55529 WP_001177639.1.55550 WP_001177639.1.55551 WP_001177639.1.55552 WP_001177639.1.55556 WP_001177639.1.55560 WP_001177639.1.55563 WP_001177639.1.55571 WP_001177639.1.55581 WP_001177639.1.55597 WP_001177639.1.55608 WP_001177639.1.5561 WP_001177639.1.55629 WP_001177639.1.5566 WP_001177639.1.55676 WP_001177639.1.55720 WP_001177639.1.55727 WP_001177639.1.55731 WP_001177639.1.55744 WP_001177639.1.55757 WP_001177639.1.55787 WP_001177639.1.55790 WP_001177639.1.55791 WP_001177639.1.55808 WP_001177639.1.55820 WP_001177639.1.55825 WP_001177639.1.55838 WP_001177639.1.55844 WP_001177639.1.55868 WP_001177639.1.55870 WP_001177639.1.55888 WP_001177639.1.55896 WP_001177639.1.55936 WP_001177639.1.55979 WP_001177639.1.55981 WP_001177639.1.55988 WP_001177639.1.55990 WP_001177639.1.56033 WP_001177639.1.56040 WP_001177639.1.56047 WP_001177639.1.56072 WP_001177639.1.56101 WP_001177639.1.56122 WP_001177639.1.56139 WP_001177639.1.5614 WP_001177639.1.56142 WP_001177639.1.56149 WP_001177639.1.56151 WP_001177639.1.5616 WP_001177639.1.56164 WP_001177639.1.56169 WP_001177639.1.56177 WP_001177639.1.56193 WP_001177639.1.562 WP_001177639.1.56216 WP_001177639.1.56231 WP_001177639.1.56278 WP_001177639.1.56293 WP_001177639.1.5632 WP_001177639.1.56338 WP_001177639.1.56345 WP_001177639.1.56358 WP_001177639.1.56388 WP_001177639.1.5639 WP_001177639.1.56390 WP_001177639.1.56392 WP_001177639.1.56399 WP_001177639.1.56402 WP_001177639.1.56436 WP_001177639.1.56439 WP_001177639.1.56446 WP_001177639.1.56457 WP_001177639.1.5646 WP_001177639.1.56469 WP_001177639.1.56481 WP_001177639.1.5649 WP_001177639.1.56491 WP_001177639.1.56501 WP_001177639.1.56502 WP_001177639.1.56523 WP_001177639.1.56543 WP_001177639.1.56554 WP_001177639.1.56573 WP_001177639.1.56650 WP_001177639.1.56662 WP_001177639.1.56665 WP_001177639.1.56680 WP_001177639.1.56689 WP_001177639.1.5670 WP_001177639.1.56704 WP_001177639.1.56713 WP_001177639.1.56714 WP_001177639.1.56721 WP_001177639.1.56776 WP_001177639.1.56777 WP_001177639.1.56786 WP_001177639.1.56787 WP_001177639.1.56789 WP_001177639.1.56821 WP_001177639.1.56835 WP_001177639.1.56846 WP_001177639.1.56871 WP_001177639.1.56885 WP_001177639.1.56908 WP_001177639.1.56933 WP_001177639.1.56934 WP_001177639.1.56936 WP_001177639.1.56937 WP_001177639.1.56941 WP_001177639.1.56951 WP_001177639.1.56980 WP_001177639.1.56992 WP_001177639.1.57011 WP_001177639.1.57032 WP_001177639.1.57045 WP_001177639.1.57051 WP_001177639.1.57068 WP_001177639.1.57071 WP_001177639.1.57072 WP_001177639.1.57079 WP_001177639.1.57086 WP_001177639.1.57124 WP_001177639.1.57150 WP_001177639.1.57181 WP_001177639.1.57182 WP_001177639.1.57185 WP_001177639.1.57197 WP_001177639.1.57202 WP_001177639.1.57213 WP_001177639.1.57254 WP_001177639.1.57266 WP_001177639.1.57269 WP_001177639.1.57278 WP_001177639.1.57280 WP_001177639.1.57281 WP_001177639.1.57319 WP_001177639.1.57348 WP_001177639.1.57386 WP_001177639.1.57395 WP_001177639.1.57403 WP_001177639.1.57410 WP_001177639.1.57414 WP_001177639.1.57432 WP_001177639.1.57438 WP_001177639.1.57451 WP_001177639.1.57453 WP_001177639.1.5748 WP_001177639.1.57487 WP_001177639.1.57492 WP_001177639.1.57517 WP_001177639.1.57539 WP_001177639.1.5755 WP_001177639.1.57550 WP_001177639.1.57574 WP_001177639.1.57588 WP_001177639.1.57608 WP_001177639.1.57628 WP_001177639.1.57634 WP_001177639.1.57663 WP_001177639.1.57669 WP_001177639.1.57719 WP_001177639.1.57738 WP_001177639.1.57812 WP_001177639.1.57814 WP_001177639.1.57832 WP_001177639.1.57836 WP_001177639.1.57846 WP_001177639.1.57854 WP_001177639.1.5787 WP_001177639.1.57898 WP_001177639.1.57903 WP_001177639.1.57920 WP_001177639.1.57951 WP_001177639.1.57975 WP_001177639.1.57982 WP_001177639.1.57983 WP_001177639.1.57994 WP_001177639.1.58001 WP_001177639.1.58009 WP_001177639.1.58022 WP_001177639.1.58038 WP_001177639.1.58048 WP_001177639.1.58060 WP_001177639.1.58080 WP_001177639.1.58092 WP_001177639.1.58094 WP_001177639.1.58098 WP_001177639.1.58107 WP_001177639.1.5812 WP_001177639.1.58128 WP_001177639.1.58136 WP_001177639.1.58143 WP_001177639.1.58169 WP_001177639.1.58172 WP_001177639.1.58226 WP_001177639.1.58232 WP_001177639.1.58233 WP_001177639.1.58244 WP_001177639.1.58248 WP_001177639.1.58289 WP_001177639.1.58292 WP_001177639.1.58316 WP_001177639.1.58336 WP_001177639.1.58340 WP_001177639.1.58345 WP_001177639.1.58368 WP_001177639.1.58384 WP_001177639.1.58401 WP_001177639.1.58408 WP_001177639.1.58414 WP_001177639.1.5842 WP_001177639.1.58420 WP_001177639.1.58423 WP_001177639.1.58424 WP_001177639.1.58429 WP_001177639.1.58440 WP_001177639.1.58444 WP_001177639.1.58445 WP_001177639.1.58449 WP_001177639.1.58459 WP_001177639.1.58484 WP_001177639.1.58493 WP_001177639.1.58496 WP_001177639.1.585 WP_001177639.1.58507 WP_001177639.1.58528 WP_001177639.1.58552 WP_001177639.1.58560 WP_001177639.1.58572 WP_001177639.1.58582 WP_001177639.1.58609 WP_001177639.1.58617 WP_001177639.1.58657 WP_001177639.1.58680 WP_001177639.1.58692 WP_001177639.1.58705 WP_001177639.1.58723 WP_001177639.1.58737 WP_001177639.1.58799 WP_001177639.1.58837 WP_001177639.1.58867 WP_001177639.1.58901 WP_001177639.1.58940 WP_001177639.1.58942 WP_001177639.1.58951 WP_001177639.1.58958 WP_001177639.1.58976 WP_001177639.1.58977 WP_001177639.1.58983 WP_001177639.1.58999 WP_001177639.1.59024 WP_001177639.1.59038 WP_001177639.1.59047 WP_001177639.1.59055 WP_001177639.1.5906 WP_001177639.1.59060 WP_001177639.1.59073 WP_001177639.1.59083 WP_001177639.1.59119 WP_001177639.1.59165 WP_001177639.1.59174 WP_001177639.1.59190 WP_001177639.1.59199 WP_001177639.1.59218 WP_001177639.1.59226 WP_001177639.1.59263 WP_001177639.1.5927 WP_001177639.1.59291 WP_001177639.1.59292 WP_001177639.1.59302 WP_001177639.1.59306 WP_001177639.1.59359 WP_001177639.1.59396 WP_001177639.1.59407 WP_001177639.1.59413 WP_001177639.1.5942 WP_001177639.1.59423 WP_001177639.1.59425 WP_001177639.1.59426 WP_001177639.1.59470 WP_001177639.1.59483 WP_001177639.1.59513 WP_001177639.1.59553 WP_001177639.1.59572 WP_001177639.1.59577 WP_001177639.1.59579 WP_001177639.1.59590 WP_001177639.1.59611 WP_001177639.1.59613 WP_001177639.1.59615 WP_001177639.1.59621 WP_001177639.1.5963 WP_001177639.1.59638 WP_001177639.1.59660 WP_001177639.1.59679 WP_001177639.1.59689 WP_001177639.1.59699 WP_001177639.1.597 WP_001177639.1.59714 WP_001177639.1.59717 WP_001177639.1.59730 WP_001177639.1.59733 WP_001177639.1.59737 WP_001177639.1.59745 WP_001177639.1.59748 WP_001177639.1.59782 WP_001177639.1.59788 WP_001177639.1.59791 WP_001177639.1.59815 WP_001177639.1.59823 WP_001177639.1.59836 WP_001177639.1.59838 WP_001177639.1.59853 WP_001177639.1.59855 WP_001177639.1.59858 WP_001177639.1.59877 WP_001177639.1.59894 WP_001177639.1.5990 WP_001177639.1.59900 WP_001177639.1.59914 WP_001177639.1.59931 WP_001177639.1.59932 WP_001177639.1.59959 WP_001177639.1.59970 WP_001177639.1.59980 WP_001177639.1.59981 WP_001177639.1.59998 WP_001177639.1.60005 WP_001177639.1.6002 WP_001177639.1.60023 WP_001177639.1.60031 WP_001177639.1.60043 WP_001177639.1.60048 WP_001177639.1.60070 WP_001177639.1.60096 WP_001177639.1.60110 WP_001177639.1.60117 WP_001177639.1.6013 WP_001177639.1.60133 WP_001177639.1.60151 WP_001177639.1.60186 WP_001177639.1.60225 WP_001177639.1.60228 WP_001177639.1.60235 WP_001177639.1.60246 WP_001177639.1.60304 WP_001177639.1.60325 WP_001177639.1.60337 WP_001177639.1.60342 WP_001177639.1.60343 WP_001177639.1.60350 WP_001177639.1.60373 WP_001177639.1.60374 WP_001177639.1.60411 WP_001177639.1.60436 WP_001177639.1.60443 WP_001177639.1.60457 WP_001177639.1.60461 WP_001177639.1.60491 WP_001177639.1.60498 WP_001177639.1.60505 WP_001177639.1.60544 WP_001177639.1.60550 WP_001177639.1.60559 WP_001177639.1.60570 WP_001177639.1.6059 WP_001177639.1.60591 WP_001177639.1.60599 WP_001177639.1.60606 WP_001177639.1.6061 WP_001177639.1.60613 WP_001177639.1.60614 WP_001177639.1.60630 WP_001177639.1.6064 WP_001177639.1.60644 WP_001177639.1.60654 WP_001177639.1.6066 WP_001177639.1.60671 WP_001177639.1.6068 WP_001177639.1.60684 WP_001177639.1.60698 WP_001177639.1.60717 WP_001177639.1.60761 WP_001177639.1.60771 WP_001177639.1.60784 WP_001177639.1.60816 WP_001177639.1.60826 WP_001177639.1.60832 WP_001177639.1.60835 WP_001177639.1.60847 WP_001177639.1.60895 WP_001177639.1.60921 WP_001177639.1.60925 WP_001177639.1.60927 WP_001177639.1.60935 WP_001177639.1.6094 WP_001177639.1.60974 WP_001177639.1.61005 WP_001177639.1.61006 WP_001177639.1.61008 WP_001177639.1.61035 WP_001177639.1.61039 WP_001177639.1.61046 WP_001177639.1.61058 WP_001177639.1.61096 WP_001177639.1.61097 WP_001177639.1.61099 WP_001177639.1.6110 WP_001177639.1.61102 WP_001177639.1.61108 WP_001177639.1.61112 WP_001177639.1.61121 WP_001177639.1.61132 WP_001177639.1.61148 WP_001177639.1.61174 WP_001177639.1.61175 WP_001177639.1.61181 WP_001177639.1.61186 WP_001177639.1.61223 WP_001177639.1.61241 WP_001177639.1.61245 WP_001177639.1.61268 WP_001177639.1.61284 WP_001177639.1.61292 WP_001177639.1.613 WP_001177639.1.61360 WP_001177639.1.61362 WP_001177639.1.61364 WP_001177639.1.61373 WP_001177639.1.6138 WP_001177639.1.61442 WP_001177639.1.61445 WP_001177639.1.61480 WP_001177639.1.61496 WP_001177639.1.615 WP_001177639.1.61512 WP_001177639.1.61517 WP_001177639.1.61524 WP_001177639.1.61612 WP_001177639.1.61617 WP_001177639.1.61623 WP_001177639.1.61636 WP_001177639.1.61643 WP_001177639.1.61663 WP_001177639.1.61703 WP_001177639.1.61718 WP_001177639.1.61739 WP_001177639.1.61772 WP_001177639.1.61779 WP_001177639.1.61789 WP_001177639.1.618 WP_001177639.1.61835 WP_001177639.1.61853 WP_001177639.1.61858 WP_001177639.1.61893 WP_001177639.1.61939 WP_001177639.1.61948 WP_001177639.1.61949 WP_001177639.1.61955 WP_001177639.1.61957 WP_001177639.1.61966 WP_001177639.1.61985 WP_001177639.1.62015 WP_001177639.1.62038 WP_001177639.1.62041 WP_001177639.1.62043 WP_001177639.1.62091 WP_001177639.1.62102 WP_001177639.1.6212 WP_001177639.1.62135 WP_001177639.1.62157 WP_001177639.1.62207 WP_001177639.1.62236 WP_001177639.1.62262 WP_001177639.1.62273 WP_001177639.1.62303 WP_001177639.1.62322 WP_001177639.1.62337 WP_001177639.1.62348 WP_001177639.1.62358 WP_001177639.1.62424 WP_001177639.1.62447 WP_001177639.1.6245 WP_001177639.1.62454 WP_001177639.1.62460 WP_001177639.1.62481 WP_001177639.1.62487 WP_001177639.1.62503 WP_001177639.1.62507 WP_001177639.1.62513 WP_001177639.1.62514 WP_001177639.1.62529 WP_001177639.1.62541 WP_001177639.1.62555 WP_001177639.1.62586 WP_001177639.1.6261 WP_001177639.1.62612 WP_001177639.1.62631 WP_001177639.1.62642 WP_001177639.1.62646 WP_001177639.1.62675 WP_001177639.1.62735 WP_001177639.1.62750 WP_001177639.1.62762 WP_001177639.1.62769 WP_001177639.1.62780 WP_001177639.1.62784 WP_001177639.1.62788 WP_001177639.1.62802 WP_001177639.1.62812 WP_001177639.1.62819 WP_001177639.1.6282 WP_001177639.1.62840 WP_001177639.1.62843 WP_001177639.1.62850 WP_001177639.1.62851 WP_001177639.1.62866 WP_001177639.1.62885 WP_001177639.1.62914 WP_001177639.1.62919 WP_001177639.1.6293 WP_001177639.1.62931 WP_001177639.1.62951 WP_001177639.1.62973 WP_001177639.1.62989 WP_001177639.1.6299 WP_001177639.1.62992 WP_001177639.1.63023 WP_001177639.1.6307 WP_001177639.1.63078 WP_001177639.1.63167 WP_001177639.1.63177 WP_001177639.1.63189 WP_001177639.1.63246 WP_001177639.1.63271 WP_001177639.1.63285 WP_001177639.1.63305 WP_001177639.1.63310 WP_001177639.1.63330 WP_001177639.1.6334 WP_001177639.1.63350 WP_001177639.1.63374 WP_001177639.1.63393 WP_001177639.1.63419 WP_001177639.1.63433 WP_001177639.1.63435 WP_001177639.1.63437 WP_001177639.1.63444 WP_001177639.1.63453 WP_001177639.1.63465 WP_001177639.1.63466 WP_001177639.1.63467 WP_001177639.1.63470 WP_001177639.1.63478 WP_001177639.1.6348 WP_001177639.1.63484 WP_001177639.1.63487 WP_001177639.1.63496 WP_001177639.1.63536 WP_001177639.1.63554 WP_001177639.1.63556 WP_001177639.1.63563 WP_001177639.1.63602 WP_001177639.1.63604 WP_001177639.1.63608 WP_001177639.1.63612 WP_001177639.1.63615 WP_001177639.1.63666 WP_001177639.1.63683 WP_001177639.1.63703 WP_001177639.1.63721 WP_001177639.1.63800 WP_001177639.1.63810 WP_001177639.1.63814 WP_001177639.1.63821 WP_001177639.1.63856 WP_001177639.1.63871 WP_001177639.1.63872 WP_001177639.1.63944 WP_001177639.1.63957 WP_001177639.1.63969 WP_001177639.1.63990 WP_001177639.1.64014 WP_001177639.1.64030 WP_001177639.1.64040 WP_001177639.1.64045 WP_001177639.1.64050 WP_001177639.1.64053 WP_001177639.1.64074 WP_001177639.1.64080 WP_001177639.1.64086 WP_001177639.1.64138 WP_001177639.1.64150 WP_001177639.1.64153 WP_001177639.1.6416 WP_001177639.1.64161 WP_001177639.1.64165 WP_001177639.1.64180 WP_001177639.1.64190 WP_001177639.1.64280 WP_001177639.1.64285 WP_001177639.1.64286 WP_001177639.1.643 WP_001177639.1.6431 WP_001177639.1.64312 WP_001177639.1.64330 WP_001177639.1.64353 WP_001177639.1.64355 WP_001177639.1.64356 WP_001177639.1.64371 WP_001177639.1.64380 WP_001177639.1.64391 WP_001177639.1.6441 WP_001177639.1.64417 WP_001177639.1.64437 WP_001177639.1.64438 WP_001177639.1.6444 WP_001177639.1.64448 WP_001177639.1.6445 WP_001177639.1.6446 WP_001177639.1.64520 WP_001177639.1.64528 WP_001177639.1.64540 WP_001177639.1.64547 WP_001177639.1.64563 WP_001177639.1.64621 WP_001177639.1.64634 WP_001177639.1.64670 WP_001177639.1.6469 WP_001177639.1.64695 WP_001177639.1.64707 WP_001177639.1.64712 WP_001177639.1.64749 WP_001177639.1.64789 WP_001177639.1.64793 WP_001177639.1.64821 WP_001177639.1.64840 WP_001177639.1.64866 WP_001177639.1.64875 WP_001177639.1.64881 WP_001177639.1.64895 WP_001177639.1.64901 WP_001177639.1.64912 WP_001177639.1.64926 WP_001177639.1.64930 WP_001177639.1.64939 WP_001177639.1.64946 WP_001177639.1.6499 WP_001177639.1.64990 WP_001177639.1.65035 WP_001177639.1.65040 WP_001177639.1.65056 WP_001177639.1.65061 WP_001177639.1.65085 WP_001177639.1.65104 WP_001177639.1.6511 WP_001177639.1.65110 WP_001177639.1.65114 WP_001177639.1.65116 WP_001177639.1.65118 WP_001177639.1.65122 WP_001177639.1.65135 WP_001177639.1.65155 WP_001177639.1.6516 WP_001177639.1.65179 WP_001177639.1.65192 WP_001177639.1.65194 WP_001177639.1.65240 WP_001177639.1.6527 WP_001177639.1.65271 WP_001177639.1.65286 WP_001177639.1.65296 WP_001177639.1.65305 WP_001177639.1.65306 WP_001177639.1.65353 WP_001177639.1.65355 WP_001177639.1.65364 WP_001177639.1.65366 WP_001177639.1.65370 WP_001177639.1.65372 WP_001177639.1.654 WP_001177639.1.65405 WP_001177639.1.65408 WP_001177639.1.65415 WP_001177639.1.65456 WP_001177639.1.65484 WP_001177639.1.6553 WP_001177639.1.65546 WP_001177639.1.65565 WP_001177639.1.65571 WP_001177639.1.65581 WP_001177639.1.65606 WP_001177639.1.6563 WP_001177639.1.65667 WP_001177639.1.65672 WP_001177639.1.65677 WP_001177639.1.65708 WP_001177639.1.65714 WP_001177639.1.65749 WP_001177639.1.6576 WP_001177639.1.65834 WP_001177639.1.6587 WP_001177639.1.65875 WP_001177639.1.65898 WP_001177639.1.65912 WP_001177639.1.65954 WP_001177639.1.65957 WP_001177639.1.65961 WP_001177639.1.65962 WP_001177639.1.65963 WP_001177639.1.65976 WP_001177639.1.65978 WP_001177639.1.65988 WP_001177639.1.66001 WP_001177639.1.66016 WP_001177639.1.66017 WP_001177639.1.66022 WP_001177639.1.66033 WP_001177639.1.6604 WP_001177639.1.66044 WP_001177639.1.66059 WP_001177639.1.66071 WP_001177639.1.6609 WP_001177639.1.66102 WP_001177639.1.66104 WP_001177639.1.66121 WP_001177639.1.66161 WP_001177639.1.6618 WP_001177639.1.66181 WP_001177639.1.66187 WP_001177639.1.6622 WP_001177639.1.66255 WP_001177639.1.66264 WP_001177639.1.66288 WP_001177639.1.66290 WP_001177639.1.66295 WP_001177639.1.66335 WP_001177639.1.6635 WP_001177639.1.66376 WP_001177639.1.66389 WP_001177639.1.66392 WP_001177639.1.66395 WP_001177639.1.66412 WP_001177639.1.66421 WP_001177639.1.66432 WP_001177639.1.66448 WP_001177639.1.66501 WP_001177639.1.66511 WP_001177639.1.66523 WP_001177639.1.66531 WP_001177639.1.6654 WP_001177639.1.66550 WP_001177639.1.66559 WP_001177639.1.66566 WP_001177639.1.66624 WP_001177639.1.6665 WP_001177639.1.6666 WP_001177639.1.66667 WP_001177639.1.66668 WP_001177639.1.66700 WP_001177639.1.66706 WP_001177639.1.66708 WP_001177639.1.66719 WP_001177639.1.66727 WP_001177639.1.66751 WP_001177639.1.66787 WP_001177639.1.66791 WP_001177639.1.66794 WP_001177639.1.66796 WP_001177639.1.66849 WP_001177639.1.66873 WP_001177639.1.66922 WP_001177639.1.66926 WP_001177639.1.66933 WP_001177639.1.66948 WP_001177639.1.66975 WP_001177639.1.66978 WP_001177639.1.6698 WP_001177639.1.66984 WP_001177639.1.6701 WP_001177639.1.67018 WP_001177639.1.67022 WP_001177639.1.67026 WP_001177639.1.67035 WP_001177639.1.67047 WP_001177639.1.67055 WP_001177639.1.6706 WP_001177639.1.67102 WP_001177639.1.67116 WP_001177639.1.67120 WP_001177639.1.67132 WP_001177639.1.67136 WP_001177639.1.67137 WP_001177639.1.67149 WP_001177639.1.67150 WP_001177639.1.67153 WP_001177639.1.67158 WP_001177639.1.67164 WP_001177639.1.67174 WP_001177639.1.67193 WP_001177639.1.67210 WP_001177639.1.67214 WP_001177639.1.6723 WP_001177639.1.67258 WP_001177639.1.67284 WP_001177639.1.67293 WP_001177639.1.6735 WP_001177639.1.67373 WP_001177639.1.67383 WP_001177639.1.67412 WP_001177639.1.67415 WP_001177639.1.67427 WP_001177639.1.67446 WP_001177639.1.67451 WP_001177639.1.67452 WP_001177639.1.67454 WP_001177639.1.67456 WP_001177639.1.67462 WP_001177639.1.67464 WP_001177639.1.67467 WP_001177639.1.67468 WP_001177639.1.67495 WP_001177639.1.67522 WP_001177639.1.67533 WP_001177639.1.67538 WP_001177639.1.67553 WP_001177639.1.67581 WP_001177639.1.67606 WP_001177639.1.67663 WP_001177639.1.67669 WP_001177639.1.67676 WP_001177639.1.67681 WP_001177639.1.67685 WP_001177639.1.6769 WP_001177639.1.67690 WP_001177639.1.67701 WP_001177639.1.67704 WP_001177639.1.67724 WP_001177639.1.67732 WP_001177639.1.67737 WP_001177639.1.67753 WP_001177639.1.67758 WP_001177639.1.67760 WP_001177639.1.67775 WP_001177639.1.67780 WP_001177639.1.67786 WP_001177639.1.67802 WP_001177639.1.67810 WP_001177639.1.67853 WP_001177639.1.67891 WP_001177639.1.67894 WP_001177639.1.67901 WP_001177639.1.6793 WP_001177639.1.67938 WP_001177639.1.67975 WP_001177639.1.67984 WP_001177639.1.67990 WP_001177639.1.67992 WP_001177639.1.68008 WP_001177639.1.68012 WP_001177639.1.6802 WP_001177639.1.68025 WP_001177639.1.6803 WP_001177639.1.68052 WP_001177639.1.68053 WP_001177639.1.68058 WP_001177639.1.68059 WP_001177639.1.68063 WP_001177639.1.68067 WP_001177639.1.68069 WP_001177639.1.68070 WP_001177639.1.68071 WP_001177639.1.68096 WP_001177639.1.6810 WP_001177639.1.68108 WP_001177639.1.68126 WP_001177639.1.68138 WP_001177639.1.6814 WP_001177639.1.68145 WP_001177639.1.68157 WP_001177639.1.68170 WP_001177639.1.68177 WP_001177639.1.682 WP_001177639.1.68200 WP_001177639.1.68215 WP_001177639.1.68231 WP_001177639.1.68241 WP_001177639.1.68255 WP_001177639.1.68271 WP_001177639.1.68279 WP_001177639.1.68281 WP_001177639.1.68292 WP_001177639.1.68300 WP_001177639.1.68336 WP_001177639.1.68341 WP_001177639.1.68362 WP_001177639.1.68369 WP_001177639.1.68372 WP_001177639.1.68395 WP_001177639.1.68441 WP_001177639.1.68442 WP_001177639.1.68482 WP_001177639.1.68490 WP_001177639.1.68493 WP_001177639.1.68523 WP_001177639.1.68524 WP_001177639.1.68566 WP_001177639.1.68572 WP_001177639.1.68584 WP_001177639.1.6859 WP_001177639.1.68598 WP_001177639.1.6860 WP_001177639.1.68609 WP_001177639.1.68630 WP_001177639.1.68632 WP_001177639.1.68635 WP_001177639.1.68673 WP_001177639.1.68678 WP_001177639.1.68679 WP_001177639.1.68701 WP_001177639.1.68711 WP_001177639.1.68735 WP_001177639.1.68750 WP_001177639.1.68751 WP_001177639.1.68752 WP_001177639.1.68793 WP_001177639.1.68795 WP_001177639.1.68797 WP_001177639.1.6880 WP_001177639.1.68838 WP_001177639.1.68847 WP_001177639.1.68865 WP_001177639.1.6887 WP_001177639.1.68877 WP_001177639.1.68880 WP_001177639.1.68911 WP_001177639.1.68915 WP_001177639.1.6892 WP_001177639.1.68924 WP_001177639.1.68936 WP_001177639.1.68942 WP_001177639.1.68952 WP_001177639.1.68961 WP_001177639.1.6897 WP_001177639.1.68989 WP_001177639.1.68995 WP_001177639.1.69039 WP_001177639.1.69054 WP_001177639.1.69098 WP_001177639.1.69127 WP_001177639.1.6916 WP_001177639.1.69160 WP_001177639.1.6919 WP_001177639.1.69192 WP_001177639.1.6921 WP_001177639.1.69221 WP_001177639.1.6923 WP_001177639.1.69258 WP_001177639.1.69261 WP_001177639.1.6929 WP_001177639.1.69303 WP_001177639.1.69305 WP_001177639.1.69327 WP_001177639.1.69341 WP_001177639.1.69350 WP_001177639.1.69351 WP_001177639.1.69382 WP_001177639.1.69390 WP_001177639.1.69404 WP_001177639.1.69438 WP_001177639.1.69441 WP_001177639.1.69450 WP_001177639.1.69472 WP_001177639.1.69473 WP_001177639.1.69502 WP_001177639.1.69506 WP_001177639.1.69537 WP_001177639.1.69569 WP_001177639.1.69589 WP_001177639.1.69596 WP_001177639.1.69605 WP_001177639.1.69643 WP_001177639.1.69646 WP_001177639.1.69655 WP_001177639.1.69689 WP_001177639.1.697 WP_001177639.1.69716 WP_001177639.1.69730 WP_001177639.1.69786 WP_001177639.1.69803 WP_001177639.1.69818 WP_001177639.1.69831 WP_001177639.1.69832 WP_001177639.1.69868 WP_001177639.1.69872 WP_001177639.1.69896 WP_001177639.1.6993 WP_001177639.1.69963 WP_001177639.1.69972 WP_001177639.1.69979 WP_001177639.1.69999 WP_001177639.1.7001 WP_001177639.1.70041 WP_001177639.1.70063 WP_001177639.1.70081 WP_001177639.1.701 WP_001177639.1.70123 WP_001177639.1.70125 WP_001177639.1.7013 WP_001177639.1.70149 WP_001177639.1.7015 WP_001177639.1.70190 WP_001177639.1.70191 WP_001177639.1.70200 WP_001177639.1.70213 WP_001177639.1.70230 WP_001177639.1.70251 WP_001177639.1.70256 WP_001177639.1.70264 WP_001177639.1.70299 WP_001177639.1.70300 WP_001177639.1.70337 WP_001177639.1.70341 WP_001177639.1.70357 WP_001177639.1.70386 WP_001177639.1.70408 WP_001177639.1.70414 WP_001177639.1.7050 WP_001177639.1.70509 WP_001177639.1.70517 WP_001177639.1.70530 WP_001177639.1.70563 WP_001177639.1.70576 WP_001177639.1.70578 WP_001177639.1.70582 WP_001177639.1.70597 WP_001177639.1.70600 WP_001177639.1.70628 WP_001177639.1.70655 WP_001177639.1.70656 WP_001177639.1.70686 WP_001177639.1.70698 WP_001177639.1.70705 WP_001177639.1.70713 WP_001177639.1.70723 WP_001177639.1.70728 WP_001177639.1.70745 WP_001177639.1.70747 WP_001177639.1.70787 WP_001177639.1.70794 WP_001177639.1.70801 WP_001177639.1.70803 WP_001177639.1.70880 WP_001177639.1.70896 WP_001177639.1.7090 WP_001177639.1.70900 WP_001177639.1.70952 WP_001177639.1.70967 WP_001177639.1.71003 WP_001177639.1.7102 WP_001177639.1.71024 WP_001177639.1.71037 WP_001177639.1.71099 WP_001177639.1.71109 WP_001177639.1.71113 WP_001177639.1.71134 WP_001177639.1.71139 WP_001177639.1.71144 WP_001177639.1.71147 WP_001177639.1.71158 WP_001177639.1.71159 WP_001177639.1.71162 WP_001177639.1.71170 WP_001177639.1.71176 WP_001177639.1.71183 WP_001177639.1.71199 WP_001177639.1.71205 WP_001177639.1.7121 WP_001177639.1.71223 WP_001177639.1.71226 WP_001177639.1.71264 WP_001177639.1.71269 WP_001177639.1.71272 WP_001177639.1.71273 WP_001177639.1.71275 WP_001177639.1.71285 WP_001177639.1.71287 WP_001177639.1.71294 WP_001177639.1.71311 WP_001177639.1.71323 WP_001177639.1.71327 WP_001177639.1.71339 WP_001177639.1.71397 WP_001177639.1.71403 WP_001177639.1.71409 WP_001177639.1.71421 WP_001177639.1.71423 WP_001177639.1.71448 WP_001177639.1.7147 WP_001177639.1.71522 WP_001177639.1.71533 WP_001177639.1.71537 WP_001177639.1.71538 WP_001177639.1.71560 WP_001177639.1.71562 WP_001177639.1.71563 WP_001177639.1.71607 WP_001177639.1.71680 WP_001177639.1.71690 WP_001177639.1.71695 WP_001177639.1.71724 WP_001177639.1.71732 WP_001177639.1.71757 WP_001177639.1.71767 WP_001177639.1.71783 WP_001177639.1.71830 WP_001177639.1.71832 WP_001177639.1.71837 WP_001177639.1.71840 WP_001177639.1.71855 WP_001177639.1.71874 WP_001177639.1.71912 WP_001177639.1.71922 WP_001177639.1.71938 WP_001177639.1.71939 WP_001177639.1.71940 WP_001177639.1.71944 WP_001177639.1.71945 WP_001177639.1.71967 WP_001177639.1.71972 WP_001177639.1.71975 WP_001177639.1.71987 WP_001177639.1.71993 WP_001177639.1.71995 WP_001177639.1.72013 WP_001177639.1.72016 WP_001177639.1.72028 WP_001177639.1.72033 WP_001177639.1.72048 WP_001177639.1.72053 WP_001177639.1.72054 WP_001177639.1.72066 WP_001177639.1.72090 WP_001177639.1.72098 WP_001177639.1.7210 WP_001177639.1.72117 WP_001177639.1.72120 WP_001177639.1.72125 WP_001177639.1.72126 WP_001177639.1.72141 WP_001177639.1.72155 WP_001177639.1.72157 WP_001177639.1.72161 WP_001177639.1.72162 WP_001177639.1.72180 WP_001177639.1.72186 WP_001177639.1.72208 WP_001177639.1.72212 WP_001177639.1.72248 WP_001177639.1.7225 WP_001177639.1.72258 WP_001177639.1.72261 WP_001177639.1.72262 WP_001177639.1.72270 WP_001177639.1.72279 WP_001177639.1.72290 WP_001177639.1.72293 WP_001177639.1.72298 WP_001177639.1.723 WP_001177639.1.72316 WP_001177639.1.72322 WP_001177639.1.72337 WP_001177639.1.72342 WP_001177639.1.72352 WP_001177639.1.72359 WP_001177639.1.72362 WP_001177639.1.72388 WP_001177639.1.72391 WP_001177639.1.72392 WP_001177639.1.72397 WP_001177639.1.72414 WP_001177639.1.72425 WP_001177639.1.72427 WP_001177639.1.72431 WP_001177639.1.72436 WP_001177639.1.72449 WP_001177639.1.72469 WP_001177639.1.72485 WP_001177639.1.72493 WP_001177639.1.72507 WP_001177639.1.72521 WP_001177639.1.72522 WP_001177639.1.72535 WP_001177639.1.72537 WP_001177639.1.72544 WP_001177639.1.72551 WP_001177639.1.72574 WP_001177639.1.72588 WP_001177639.1.72593 WP_001177639.1.72596 WP_001177639.1.72599 WP_001177639.1.72606 WP_001177639.1.72615 WP_001177639.1.72616 WP_001177639.1.72619 WP_001177639.1.72641 WP_001177639.1.72643 WP_001177639.1.72651 WP_001177639.1.72694 WP_001177639.1.72700 WP_001177639.1.72706 WP_001177639.1.72738 WP_001177639.1.72745 WP_001177639.1.72747 WP_001177639.1.72748 WP_001177639.1.72751 WP_001177639.1.72764 WP_001177639.1.72778 WP_001177639.1.72804 WP_001177639.1.72806 WP_001177639.1.7281 WP_001177639.1.72857 WP_001177639.1.72858 WP_001177639.1.72860 WP_001177639.1.72869 WP_001177639.1.72893 WP_001177639.1.7291 WP_001177639.1.72910 WP_001177639.1.72950 WP_001177639.1.72956 WP_001177639.1.72962 WP_001177639.1.72998 WP_001177639.1.73000 WP_001177639.1.73010 WP_001177639.1.73015 WP_001177639.1.73032 WP_001177639.1.73039 WP_001177639.1.73061 WP_001177639.1.73075 WP_001177639.1.73085 WP_001177639.1.7309 WP_001177639.1.73094 WP_001177639.1.73129 WP_001177639.1.73193 WP_001177639.1.73215 WP_001177639.1.73217 WP_001177639.1.73230 WP_001177639.1.73239 WP_001177639.1.73243 WP_001177639.1.73249 WP_001177639.1.73251 WP_001177639.1.73257 WP_001177639.1.73259 WP_001177639.1.73277 WP_001177639.1.73278 WP_001177639.1.73283 WP_001177639.1.73291 WP_001177639.1.73292 WP_001177639.1.73326 WP_001177639.1.73333 WP_001177639.1.73344 WP_001177639.1.73385 WP_001177639.1.73393 WP_001177639.1.73428 WP_001177639.1.73430 WP_001177639.1.7345 WP_001177639.1.73468 WP_001177639.1.73486 WP_001177639.1.73498 WP_001177639.1.73565 WP_001177639.1.73572 WP_001177639.1.73592 WP_001177639.1.73604 WP_001177639.1.73626 WP_001177639.1.73631 WP_001177639.1.73652 WP_001177639.1.73663 WP_001177639.1.73709 WP_001177639.1.73717 WP_001177639.1.73748 WP_001177639.1.73783 WP_001177639.1.73785 WP_001177639.1.73797 WP_001177639.1.73801 WP_001177639.1.73811 WP_001177639.1.73827 WP_001177639.1.73835 WP_001177639.1.73843 WP_001177639.1.73846 WP_001177639.1.73859 WP_001177639.1.73882 WP_001177639.1.73897 WP_001177639.1.73908 WP_001177639.1.73934 WP_001177639.1.73942 WP_001177639.1.73968 WP_001177639.1.73980 WP_001177639.1.73995 WP_001177639.1.73996 WP_001177639.1.74032 WP_001177639.1.74041 WP_001177639.1.74045 WP_001177639.1.74046 WP_001177639.1.74053 WP_001177639.1.7407 WP_001177639.1.74123 WP_001177639.1.7413 WP_001177639.1.74156 WP_001177639.1.74184 WP_001177639.1.74185 WP_001177639.1.74213 WP_001177639.1.74223 WP_001177639.1.7424 WP_001177639.1.74243 WP_001177639.1.7425 WP_001177639.1.74251 WP_001177639.1.74267 WP_001177639.1.74294 WP_001177639.1.74309 WP_001177639.1.74358 WP_001177639.1.74365 WP_001177639.1.74367 WP_001177639.1.744 WP_001177639.1.74426 WP_001177639.1.74431 WP_001177639.1.7446 WP_001177639.1.74465 WP_001177639.1.74478 WP_001177639.1.74491 WP_001177639.1.74501 WP_001177639.1.74509 WP_001177639.1.74513 WP_001177639.1.74520 WP_001177639.1.74528 WP_001177639.1.74532 WP_001177639.1.74536 WP_001177639.1.74549 WP_001177639.1.74557 WP_001177639.1.74574 WP_001177639.1.7461 WP_001177639.1.74611 WP_001177639.1.74623 WP_001177639.1.74624 WP_001177639.1.74625 WP_001177639.1.74631 WP_001177639.1.74652 WP_001177639.1.74682 WP_001177639.1.74688 WP_001177639.1.74689 WP_001177639.1.74691 WP_001177639.1.7471 WP_001177639.1.74716 WP_001177639.1.74720 WP_001177639.1.74735 WP_001177639.1.7475 WP_001177639.1.74752 WP_001177639.1.74765 WP_001177639.1.74767 WP_001177639.1.7479 WP_001177639.1.74793 WP_001177639.1.74811 WP_001177639.1.74828 WP_001177639.1.74852 WP_001177639.1.74867 WP_001177639.1.74873 WP_001177639.1.74879 WP_001177639.1.74880 WP_001177639.1.74885 WP_001177639.1.74895 WP_001177639.1.74904 WP_001177639.1.74914 WP_001177639.1.74915 WP_001177639.1.74962 WP_001177639.1.74975 WP_001177639.1.74993 WP_001177639.1.74998 WP_001177639.1.75003 WP_001177639.1.75021 WP_001177639.1.75029 WP_001177639.1.75030 WP_001177639.1.75050 WP_001177639.1.75087 WP_001177639.1.75100 WP_001177639.1.75112 WP_001177639.1.75118 WP_001177639.1.75124 WP_001177639.1.75136 WP_001177639.1.75138 WP_001177639.1.75143 WP_001177639.1.75145 WP_001177639.1.75149 WP_001177639.1.75155 WP_001177639.1.7516 WP_001177639.1.75181 WP_001177639.1.75218 WP_001177639.1.75219 WP_001177639.1.75221 WP_001177639.1.75228 WP_001177639.1.75243 WP_001177639.1.75247 WP_001177639.1.75248 WP_001177639.1.75254 WP_001177639.1.75270 WP_001177639.1.75272 WP_001177639.1.75306 WP_001177639.1.7536 WP_001177639.1.75360 WP_001177639.1.75382 WP_001177639.1.75419 WP_001177639.1.75435 WP_001177639.1.75491 WP_001177639.1.75505 WP_001177639.1.75507 WP_001177639.1.75529 WP_001177639.1.75537 WP_001177639.1.75557 WP_001177639.1.75568 WP_001177639.1.75577 WP_001177639.1.75588 WP_001177639.1.75594 WP_001177639.1.75602 WP_001177639.1.75612 WP_001177639.1.75629 WP_001177639.1.75644 WP_001177639.1.75676 WP_001177639.1.75687 WP_001177639.1.75698 WP_001177639.1.75699 WP_001177639.1.75725 WP_001177639.1.75735 WP_001177639.1.75767 WP_001177639.1.75786 WP_001177639.1.75803 WP_001177639.1.75808 WP_001177639.1.75839 WP_001177639.1.75892 WP_001177639.1.75918 WP_001177639.1.75922 WP_001177639.1.7597 WP_001177639.1.75983 WP_001177639.1.75995 WP_001177639.1.76005 WP_001177639.1.76019 WP_001177639.1.7603 WP_001177639.1.76030 WP_001177639.1.76036 WP_001177639.1.76039 WP_001177639.1.76054 WP_001177639.1.76057 WP_001177639.1.7608 WP_001177639.1.76089 WP_001177639.1.76103 WP_001177639.1.76118 WP_001177639.1.76119 WP_001177639.1.76129 WP_001177639.1.7613 WP_001177639.1.76152 WP_001177639.1.7617 WP_001177639.1.76184 WP_001177639.1.76189 WP_001177639.1.76194 WP_001177639.1.76196 WP_001177639.1.76211 WP_001177639.1.76237 WP_001177639.1.76268 WP_001177639.1.76269 WP_001177639.1.76305 WP_001177639.1.76312 WP_001177639.1.76325 WP_001177639.1.76335 WP_001177639.1.76361 WP_001177639.1.7637 WP_001177639.1.76387 WP_001177639.1.76390 WP_001177639.1.76407 WP_001177639.1.76446 WP_001177639.1.76447 WP_001177639.1.76448 WP_001177639.1.76452 WP_001177639.1.76460 WP_001177639.1.76462 WP_001177639.1.76466 WP_001177639.1.76469 WP_001177639.1.76504 WP_001177639.1.76542 WP_001177639.1.76544 WP_001177639.1.76595 WP_001177639.1.76596 WP_001177639.1.76612 WP_001177639.1.76619 WP_001177639.1.76656 WP_001177639.1.76660 WP_001177639.1.76701 WP_001177639.1.76705 WP_001177639.1.76751 WP_001177639.1.76759 WP_001177639.1.7680 WP_001177639.1.76815 WP_001177639.1.76831 WP_001177639.1.76840 WP_001177639.1.76863 WP_001177639.1.76884 WP_001177639.1.7689 WP_001177639.1.76909 WP_001177639.1.76918 WP_001177639.1.76933 WP_001177639.1.76957 WP_001177639.1.76961 WP_001177639.1.76966 WP_001177639.1.7699 WP_001177639.1.76994 WP_001177639.1.77007 WP_001177639.1.77015 WP_001177639.1.77022 WP_001177639.1.77036 WP_001177639.1.77042 WP_001177639.1.77057 WP_001177639.1.77081 WP_001177639.1.77099 WP_001177639.1.771 WP_001177639.1.77109 WP_001177639.1.77120 WP_001177639.1.77128 WP_001177639.1.77134 WP_001177639.1.77147 WP_001177639.1.77162 WP_001177639.1.77163 WP_001177639.1.77173 WP_001177639.1.77198 WP_001177639.1.77200 WP_001177639.1.77204 WP_001177639.1.77214 WP_001177639.1.77224 WP_001177639.1.77239 WP_001177639.1.77253 WP_001177639.1.77255 WP_001177639.1.77288 WP_001177639.1.7729 WP_001177639.1.77290 WP_001177639.1.77291 WP_001177639.1.77296 WP_001177639.1.7731 WP_001177639.1.77320 WP_001177639.1.77326 WP_001177639.1.77358 WP_001177639.1.77391 WP_001177639.1.77408 WP_001177639.1.77419 WP_001177639.1.77432 WP_001177639.1.77448 WP_001177639.1.77455 WP_001177639.1.77462 WP_001177639.1.7747 WP_001177639.1.77470 WP_001177639.1.77477 WP_001177639.1.77481 WP_001177639.1.77487 WP_001177639.1.77495 WP_001177639.1.775 WP_001177639.1.7750 WP_001177639.1.77503 WP_001177639.1.77511 WP_001177639.1.77542 WP_001177639.1.77551 WP_001177639.1.7756 WP_001177639.1.77577 WP_001177639.1.77595 WP_001177639.1.77600 WP_001177639.1.77608 WP_001177639.1.77626 WP_001177639.1.77632 WP_001177639.1.77636 WP_001177639.1.77643 WP_001177639.1.77644 WP_001177639.1.77648 WP_001177639.1.77657 WP_001177639.1.77707 WP_001177639.1.77725 WP_001177639.1.77741 WP_001177639.1.7775 WP_001177639.1.77767 WP_001177639.1.77768 WP_001177639.1.7780 WP_001177639.1.7781 WP_001177639.1.77813 WP_001177639.1.77816 WP_001177639.1.77826 WP_001177639.1.77876 WP_001177639.1.7795 WP_001177639.1.77950 WP_001177639.1.77979 WP_001177639.1.7799 WP_001177639.1.78000 WP_001177639.1.78010 WP_001177639.1.7804 WP_001177639.1.78041 WP_001177639.1.78059 WP_001177639.1.7806 WP_001177639.1.78063 WP_001177639.1.78089 WP_001177639.1.78097 WP_001177639.1.78099 WP_001177639.1.78101 WP_001177639.1.78102 WP_001177639.1.78131 WP_001177639.1.78183 WP_001177639.1.78187 WP_001177639.1.78188 WP_001177639.1.78196 WP_001177639.1.78202 WP_001177639.1.78232 WP_001177639.1.78233 WP_001177639.1.78305 WP_001177639.1.78321 WP_001177639.1.78337 WP_001177639.1.78340 WP_001177639.1.78368 WP_001177639.1.78376 WP_001177639.1.78377 WP_001177639.1.78390 WP_001177639.1.78445 WP_001177639.1.78453 WP_001177639.1.78463 WP_001177639.1.7847 WP_001177639.1.78477 WP_001177639.1.78491 WP_001177639.1.7851 WP_001177639.1.78512 WP_001177639.1.78523 WP_001177639.1.7855 WP_001177639.1.78553 WP_001177639.1.78575 WP_001177639.1.78581 WP_001177639.1.78583 WP_001177639.1.78593 WP_001177639.1.78612 WP_001177639.1.78622 WP_001177639.1.78677 WP_001177639.1.78687 WP_001177639.1.78689 WP_001177639.1.78696 WP_001177639.1.78698 WP_001177639.1.78706 WP_001177639.1.78714 WP_001177639.1.78718 WP_001177639.1.78746 WP_001177639.1.78750 WP_001177639.1.78757 WP_001177639.1.78773 WP_001177639.1.78775 WP_001177639.1.78814 WP_001177639.1.7883 WP_001177639.1.78843 WP_001177639.1.78845 WP_001177639.1.78891 WP_001177639.1.78893 WP_001177639.1.78895 WP_001177639.1.78908 WP_001177639.1.78953 WP_001177639.1.78955 WP_001177639.1.7896 WP_001177639.1.7898 WP_001177639.1.78996 WP_001177639.1.79001 WP_001177639.1.79002 WP_001177639.1.79004 WP_001177639.1.7901 WP_001177639.1.79067 WP_001177639.1.79086 WP_001177639.1.79088 WP_001177639.1.79090 WP_001177639.1.79092 WP_001177639.1.79100 WP_001177639.1.79126 WP_001177639.1.79159 WP_001177639.1.79226 WP_001177639.1.79233 WP_001177639.1.79243 WP_001177639.1.79248 WP_001177639.1.79249 WP_001177639.1.79276 WP_001177639.1.79308 WP_001177639.1.79312 WP_001177639.1.79342 WP_001177639.1.79343 WP_001177639.1.79348 WP_001177639.1.79365 WP_001177639.1.79368 WP_001177639.1.79389 WP_001177639.1.7940 WP_001177639.1.79409 WP_001177639.1.79414 WP_001177639.1.79416 WP_001177639.1.79443 WP_001177639.1.79478 WP_001177639.1.79519 WP_001177639.1.7952 WP_001177639.1.79526 WP_001177639.1.79528 WP_001177639.1.79540 WP_001177639.1.79558 WP_001177639.1.79563 WP_001177639.1.79576 WP_001177639.1.79591 WP_001177639.1.79606 WP_001177639.1.79619 WP_001177639.1.79640 WP_001177639.1.7967 WP_001177639.1.79685 WP_001177639.1.79707 WP_001177639.1.79713 WP_001177639.1.79715 WP_001177639.1.79749 WP_001177639.1.79759 WP_001177639.1.79824 WP_001177639.1.79840 WP_001177639.1.7985 WP_001177639.1.79866 WP_001177639.1.79869 WP_001177639.1.7987 WP_001177639.1.79930 WP_001177639.1.79933 WP_001177639.1.79936 WP_001177639.1.79944 WP_001177639.1.79952 WP_001177639.1.79955 WP_001177639.1.79973 WP_001177639.1.79984 WP_001177639.1.79995 WP_001177639.1.80 WP_001177639.1.80011 WP_001177639.1.80016 WP_001177639.1.80026 WP_001177639.1.8004 WP_001177639.1.80043 WP_001177639.1.80050 WP_001177639.1.80060 WP_001177639.1.80061 WP_001177639.1.80063 WP_001177639.1.8007 WP_001177639.1.80071 WP_001177639.1.80096 WP_001177639.1.80106 WP_001177639.1.8011 WP_001177639.1.80112 WP_001177639.1.80136 WP_001177639.1.80141 WP_001177639.1.80168 WP_001177639.1.80176 WP_001177639.1.80183 WP_001177639.1.80192 WP_001177639.1.80255 WP_001177639.1.80292 WP_001177639.1.80309 WP_001177639.1.80310 WP_001177639.1.80320 WP_001177639.1.80330 WP_001177639.1.80343 WP_001177639.1.80388 WP_001177639.1.80392 WP_001177639.1.804 WP_001177639.1.80402 WP_001177639.1.80426 WP_001177639.1.80428 WP_001177639.1.80440 WP_001177639.1.80456 WP_001177639.1.80463 WP_001177639.1.80484 WP_001177639.1.80519 WP_001177639.1.80524 WP_001177639.1.80545 WP_001177639.1.80558 WP_001177639.1.80559 WP_001177639.1.8057 WP_001177639.1.80577 WP_001177639.1.80578 WP_001177639.1.80594 WP_001177639.1.80626 WP_001177639.1.80660 WP_001177639.1.80662 WP_001177639.1.80666 WP_001177639.1.80676 WP_001177639.1.8068 WP_001177639.1.80709 WP_001177639.1.80718 WP_001177639.1.80731 WP_001177639.1.80736 WP_001177639.1.8074 WP_001177639.1.80753 WP_001177639.1.80754 WP_001177639.1.8076 WP_001177639.1.808 WP_001177639.1.80804 WP_001177639.1.80805 WP_001177639.1.80843 WP_001177639.1.80862 WP_001177639.1.80882 WP_001177639.1.80884 WP_001177639.1.80894 WP_001177639.1.8090 WP_001177639.1.8091 WP_001177639.1.80935 WP_001177639.1.80945 WP_001177639.1.80946 WP_001177639.1.80948 WP_001177639.1.80954 WP_001177639.1.80966 WP_001177639.1.810 WP_001177639.1.81026 WP_001177639.1.81032 WP_001177639.1.81034 WP_001177639.1.81036 WP_001177639.1.81056 WP_001177639.1.81070 WP_001177639.1.81071 WP_001177639.1.81098 WP_001177639.1.811 WP_001177639.1.81120 WP_001177639.1.81127 WP_001177639.1.81141 WP_001177639.1.81156 WP_001177639.1.81160 WP_001177639.1.81165 WP_001177639.1.8118 WP_001177639.1.81180 WP_001177639.1.81186 WP_001177639.1.8121 WP_001177639.1.81219 WP_001177639.1.81266 WP_001177639.1.81267 WP_001177639.1.81273 WP_001177639.1.81281 WP_001177639.1.81286 WP_001177639.1.81298 WP_001177639.1.81313 WP_001177639.1.81316 WP_001177639.1.81323 WP_001177639.1.81347 WP_001177639.1.81376 WP_001177639.1.81391 WP_001177639.1.81396 WP_001177639.1.814 WP_001177639.1.81418 WP_001177639.1.81420 WP_001177639.1.81423 WP_001177639.1.81438 WP_001177639.1.81442 WP_001177639.1.81475 WP_001177639.1.81484 WP_001177639.1.81517 WP_001177639.1.8156 WP_001177639.1.81577 WP_001177639.1.81580 WP_001177639.1.81582 WP_001177639.1.81588 WP_001177639.1.81596 WP_001177639.1.81602 WP_001177639.1.81618 WP_001177639.1.81624 WP_001177639.1.81688 WP_001177639.1.81692 WP_001177639.1.81715 WP_001177639.1.81723 WP_001177639.1.81739 WP_001177639.1.81761 WP_001177639.1.81819 WP_001177639.1.81821 WP_001177639.1.8183 WP_001177639.1.81832 WP_001177639.1.81843 WP_001177639.1.81873 WP_001177639.1.81876 WP_001177639.1.81881 WP_001177639.1.81888 WP_001177639.1.81934 WP_001177639.1.81935 WP_001177639.1.81939 WP_001177639.1.81952 WP_001177639.1.81956 WP_001177639.1.81975 WP_001177639.1.82 WP_001177639.1.82008 WP_001177639.1.82010 WP_001177639.1.82032 WP_001177639.1.82057 WP_001177639.1.82059 WP_001177639.1.82061 WP_001177639.1.82062 WP_001177639.1.82074 WP_001177639.1.82095 WP_001177639.1.82104 WP_001177639.1.82106 WP_001177639.1.82116 WP_001177639.1.82123 WP_001177639.1.82166 WP_001177639.1.82217 WP_001177639.1.82221 WP_001177639.1.82239 WP_001177639.1.82242 WP_001177639.1.82246 WP_001177639.1.82275 WP_001177639.1.82280 WP_001177639.1.82296 WP_001177639.1.82316 WP_001177639.1.82320 WP_001177639.1.82330 WP_001177639.1.8235 WP_001177639.1.82378 WP_001177639.1.82438 WP_001177639.1.82439 WP_001177639.1.82485 WP_001177639.1.82499 WP_001177639.1.82507 WP_001177639.1.82514 WP_001177639.1.82527 WP_001177639.1.82539 WP_001177639.1.8255 WP_001177639.1.82572 WP_001177639.1.82589 WP_001177639.1.82594 WP_001177639.1.82614 WP_001177639.1.82647 WP_001177639.1.82661 WP_001177639.1.82698 WP_001177639.1.82700 WP_001177639.1.82705 WP_001177639.1.82711 WP_001177639.1.82715 WP_001177639.1.82747 WP_001177639.1.82754 WP_001177639.1.8277 WP_001177639.1.82776 WP_001177639.1.82780 WP_001177639.1.82784 WP_001177639.1.82797 WP_001177639.1.82799 WP_001177639.1.82808 WP_001177639.1.82816 WP_001177639.1.82820 WP_001177639.1.82833 WP_001177639.1.82901 WP_001177639.1.82902 WP_001177639.1.82923 WP_001177639.1.8295 WP_001177639.1.82991 WP_001177639.1.83020 WP_001177639.1.83033 WP_001177639.1.83036 WP_001177639.1.83051 WP_001177639.1.83059 WP_001177639.1.8306 WP_001177639.1.8308 WP_001177639.1.83093 WP_001177639.1.83099 WP_001177639.1.831 WP_001177639.1.83118 WP_001177639.1.83125 WP_001177639.1.83127 WP_001177639.1.83140 WP_001177639.1.83144 WP_001177639.1.83151 WP_001177639.1.83160 WP_001177639.1.83177 WP_001177639.1.83205 WP_001177639.1.83214 WP_001177639.1.83218 WP_001177639.1.83224 WP_001177639.1.83238 WP_001177639.1.83253 WP_001177639.1.83256 WP_001177639.1.83286 WP_001177639.1.83313 WP_001177639.1.83321 WP_001177639.1.83330 WP_001177639.1.83340 WP_001177639.1.83375 WP_001177639.1.83384 WP_001177639.1.83415 WP_001177639.1.83466 WP_001177639.1.83481 WP_001177639.1.83506 WP_001177639.1.83537 WP_001177639.1.83544 WP_001177639.1.83582 WP_001177639.1.83644 WP_001177639.1.83660 WP_001177639.1.83668 WP_001177639.1.8368 WP_001177639.1.83684 WP_001177639.1.83706 WP_001177639.1.83735 WP_001177639.1.83762 WP_001177639.1.83807 WP_001177639.1.83820 WP_001177639.1.8384 WP_001177639.1.8386 WP_001177639.1.83879 WP_001177639.1.83911 WP_001177639.1.83936 WP_001177639.1.83947 WP_001177639.1.84014 WP_001177639.1.84021 WP_001177639.1.8405 WP_001177639.1.84059 WP_001177639.1.84060 WP_001177639.1.84074 WP_001177639.1.8408 WP_001177639.1.8411 WP_001177639.1.84140 WP_001177639.1.84164 WP_001177639.1.84197 WP_001177639.1.84215 WP_001177639.1.84219 WP_001177639.1.84221 WP_001177639.1.84264 WP_001177639.1.84298 WP_001177639.1.84316 WP_001177639.1.84319 WP_001177639.1.84326 WP_001177639.1.84331 WP_001177639.1.84348 WP_001177639.1.84402 WP_001177639.1.84405 WP_001177639.1.84410 WP_001177639.1.84436 WP_001177639.1.8444 WP_001177639.1.84462 WP_001177639.1.84464 WP_001177639.1.8447 WP_001177639.1.84473 WP_001177639.1.84476 WP_001177639.1.84484 WP_001177639.1.84486 WP_001177639.1.84518 WP_001177639.1.84531 WP_001177639.1.84534 WP_001177639.1.84584 WP_001177639.1.84639 WP_001177639.1.84656 WP_001177639.1.84657 WP_001177639.1.84668 WP_001177639.1.84675 WP_001177639.1.84697 WP_001177639.1.8470 WP_001177639.1.84731 WP_001177639.1.84740 WP_001177639.1.84768 WP_001177639.1.8477 WP_001177639.1.84797 WP_001177639.1.84875 WP_001177639.1.84878 WP_001177639.1.84881 WP_001177639.1.84893 WP_001177639.1.84894 WP_001177639.1.84916 WP_001177639.1.84929 WP_001177639.1.84941 WP_001177639.1.84948 WP_001177639.1.84966 WP_001177639.1.84972 WP_001177639.1.84986 WP_001177639.1.84989 WP_001177639.1.84990 WP_001177639.1.84994 WP_001177639.1.85002 WP_001177639.1.85008 WP_001177639.1.85025 WP_001177639.1.85048 WP_001177639.1.85052 WP_001177639.1.85077 WP_001177639.1.85085 WP_001177639.1.85105 WP_001177639.1.85106 WP_001177639.1.85125 WP_001177639.1.85129 WP_001177639.1.85138 WP_001177639.1.85141 WP_001177639.1.85155 WP_001177639.1.85156 WP_001177639.1.8517 WP_001177639.1.85175 WP_001177639.1.85188 WP_001177639.1.85216 WP_001177639.1.85241 WP_001177639.1.85247 WP_001177639.1.85252 WP_001177639.1.85253 WP_001177639.1.85255 WP_001177639.1.85260 WP_001177639.1.8530 WP_001177639.1.85305 WP_001177639.1.85310 WP_001177639.1.85320 WP_001177639.1.85329 WP_001177639.1.85335 WP_001177639.1.85336 WP_001177639.1.85342 WP_001177639.1.85361 WP_001177639.1.85369 WP_001177639.1.85384 WP_001177639.1.85385 WP_001177639.1.85416 WP_001177639.1.85435 WP_001177639.1.85500 WP_001177639.1.85504 WP_001177639.1.85546 WP_001177639.1.85554 WP_001177639.1.85556 WP_001177639.1.85558 WP_001177639.1.85563 WP_001177639.1.85578 WP_001177639.1.85593 WP_001177639.1.85601 WP_001177639.1.85623 WP_001177639.1.8564 WP_001177639.1.85657 WP_001177639.1.85685 WP_001177639.1.85722 WP_001177639.1.85752 WP_001177639.1.85762 WP_001177639.1.85767 WP_001177639.1.85773 WP_001177639.1.85781 WP_001177639.1.8579 WP_001177639.1.85793 WP_001177639.1.85800 WP_001177639.1.85857 WP_001177639.1.85895 WP_001177639.1.85944 WP_001177639.1.85948 WP_001177639.1.85969 WP_001177639.1.86 WP_001177639.1.86016 WP_001177639.1.8603 WP_001177639.1.86035 WP_001177639.1.86063 WP_001177639.1.8607 WP_001177639.1.86104 WP_001177639.1.86105 WP_001177639.1.86115 WP_001177639.1.86145 WP_001177639.1.86149 WP_001177639.1.86161 WP_001177639.1.86166 WP_001177639.1.86176 WP_001177639.1.86179 WP_001177639.1.86181 WP_001177639.1.86189 WP_001177639.1.86196 WP_001177639.1.8621 WP_001177639.1.86210 WP_001177639.1.86225 WP_001177639.1.86227 WP_001177639.1.86234 WP_001177639.1.86255 WP_001177639.1.86261 WP_001177639.1.86263 WP_001177639.1.86266 WP_001177639.1.86273 WP_001177639.1.86276 WP_001177639.1.86280 WP_001177639.1.86283 WP_001177639.1.86294 WP_001177639.1.86307 WP_001177639.1.8635 WP_001177639.1.86353 WP_001177639.1.86355 WP_001177639.1.86371 WP_001177639.1.86393 WP_001177639.1.86412 WP_001177639.1.86437 WP_001177639.1.86451 WP_001177639.1.86452 WP_001177639.1.86461 WP_001177639.1.86475 WP_001177639.1.86483 WP_001177639.1.86518 WP_001177639.1.8656 WP_001177639.1.86560 WP_001177639.1.86574 WP_001177639.1.86583 WP_001177639.1.86586 WP_001177639.1.86609 WP_001177639.1.86613 WP_001177639.1.86617 WP_001177639.1.86627 WP_001177639.1.86640 WP_001177639.1.86667 WP_001177639.1.86673 WP_001177639.1.86674 WP_001177639.1.86681 WP_001177639.1.86691 WP_001177639.1.86707 WP_001177639.1.86717 WP_001177639.1.86727 WP_001177639.1.86731 WP_001177639.1.86734 WP_001177639.1.86753 WP_001177639.1.86787 WP_001177639.1.86788 WP_001177639.1.8679 WP_001177639.1.86846 WP_001177639.1.86848 WP_001177639.1.86934 WP_001177639.1.86935 WP_001177639.1.86959 WP_001177639.1.86975 WP_001177639.1.86994 WP_001177639.1.86997 WP_001177639.1.87043 WP_001177639.1.8705 WP_001177639.1.87059 WP_001177639.1.87067 WP_001177639.1.87075 WP_001177639.1.87076 WP_001177639.1.87109 WP_001177639.1.87147 WP_001177639.1.87177 WP_001177639.1.87189 WP_001177639.1.87205 WP_001177639.1.87247 WP_001177639.1.87249 WP_001177639.1.87254 WP_001177639.1.87310 WP_001177639.1.87339 WP_001177639.1.87371 WP_001177639.1.87382 WP_001177639.1.87389 WP_001177639.1.87410 WP_001177639.1.87443 WP_001177639.1.87465 WP_001177639.1.87491 WP_001177639.1.87504 WP_001177639.1.87563 WP_001177639.1.87568 WP_001177639.1.87581 WP_001177639.1.87590 WP_001177639.1.87608 WP_001177639.1.87610 WP_001177639.1.87616 WP_001177639.1.87633 WP_001177639.1.87635 WP_001177639.1.87639 WP_001177639.1.87655 WP_001177639.1.87675 WP_001177639.1.87694 WP_001177639.1.87696 WP_001177639.1.8771 WP_001177639.1.87721 WP_001177639.1.87726 WP_001177639.1.87728 WP_001177639.1.87733 WP_001177639.1.87738 WP_001177639.1.87766 WP_001177639.1.8778 WP_001177639.1.87786 WP_001177639.1.87788 WP_001177639.1.87789 WP_001177639.1.87822 WP_001177639.1.87857 WP_001177639.1.87883 WP_001177639.1.87914 WP_001177639.1.87976 WP_001177639.1.87980 WP_001177639.1.87984 WP_001177639.1.880 WP_001177639.1.88017 WP_001177639.1.88066 WP_001177639.1.8807 WP_001177639.1.88082 WP_001177639.1.88110 WP_001177639.1.88119 WP_001177639.1.88147 WP_001177639.1.88149 WP_001177639.1.88155 WP_001177639.1.88189 WP_001177639.1.88197 WP_001177639.1.8822 WP_001177639.1.88234 WP_001177639.1.88252 WP_001177639.1.88260 WP_001177639.1.88263 WP_001177639.1.88285 WP_001177639.1.88301 WP_001177639.1.88336 WP_001177639.1.88352 WP_001177639.1.88376 WP_001177639.1.88384 WP_001177639.1.88413 WP_001177639.1.88427 WP_001177639.1.88434 WP_001177639.1.88438 WP_001177639.1.88467 WP_001177639.1.8848 WP_001177639.1.88499 WP_001177639.1.88505 WP_001177639.1.88524 WP_001177639.1.88527 WP_001177639.1.88528 WP_001177639.1.88535 WP_001177639.1.88539 WP_001177639.1.8854 WP_001177639.1.8855 WP_001177639.1.88557 WP_001177639.1.88562 WP_001177639.1.88577 WP_001177639.1.88598 WP_001177639.1.88607 WP_001177639.1.88631 WP_001177639.1.88646 WP_001177639.1.88678 WP_001177639.1.88685 WP_001177639.1.88709 WP_001177639.1.88717 WP_001177639.1.88720 WP_001177639.1.8873 WP_001177639.1.88735 WP_001177639.1.88752 WP_001177639.1.88757 WP_001177639.1.88759 WP_001177639.1.88767 WP_001177639.1.8879 WP_001177639.1.88793 WP_001177639.1.88803 WP_001177639.1.88826 WP_001177639.1.88834 WP_001177639.1.88864 WP_001177639.1.88880 WP_001177639.1.88883 WP_001177639.1.88891 WP_001177639.1.88941 WP_001177639.1.88953 WP_001177639.1.88997 WP_001177639.1.89018 WP_001177639.1.89043 WP_001177639.1.89050 WP_001177639.1.89067 WP_001177639.1.89069 WP_001177639.1.89090 WP_001177639.1.89097 WP_001177639.1.89099 WP_001177639.1.89111 WP_001177639.1.89150 WP_001177639.1.89163 WP_001177639.1.89183 WP_001177639.1.89200 WP_001177639.1.89203 WP_001177639.1.89214 WP_001177639.1.89217 WP_001177639.1.89255 WP_001177639.1.8928 WP_001177639.1.89285 WP_001177639.1.89305 WP_001177639.1.89312 WP_001177639.1.89334 WP_001177639.1.89335 WP_001177639.1.89351 WP_001177639.1.89379 WP_001177639.1.8938 WP_001177639.1.89385 WP_001177639.1.89396 WP_001177639.1.89400 WP_001177639.1.89403 WP_001177639.1.89416 WP_001177639.1.89427 WP_001177639.1.89455 WP_001177639.1.89458 WP_001177639.1.89466 WP_001177639.1.89468 WP_001177639.1.89469 WP_001177639.1.89471 WP_001177639.1.89474 WP_001177639.1.89479 WP_001177639.1.89492 WP_001177639.1.89496 WP_001177639.1.89510 WP_001177639.1.89551 WP_001177639.1.89569 WP_001177639.1.89583 WP_001177639.1.89605 WP_001177639.1.89627 WP_001177639.1.89630 WP_001177639.1.89631 WP_001177639.1.89646 WP_001177639.1.89656 WP_001177639.1.89674 WP_001177639.1.89679 WP_001177639.1.89700 WP_001177639.1.89710 WP_001177639.1.89745 WP_001177639.1.89747 WP_001177639.1.89781 WP_001177639.1.89788 WP_001177639.1.89818 WP_001177639.1.89839 WP_001177639.1.89841 WP_001177639.1.8985 WP_001177639.1.89852 WP_001177639.1.89859 WP_001177639.1.89879 WP_001177639.1.89915 WP_001177639.1.89917 WP_001177639.1.89918 WP_001177639.1.89925 WP_001177639.1.89927 WP_001177639.1.89959 WP_001177639.1.89988 WP_001177639.1.89998 WP_001177639.1.90017 WP_001177639.1.90022 WP_001177639.1.90050 WP_001177639.1.90063 WP_001177639.1.90065 WP_001177639.1.90078 WP_001177639.1.9010 WP_001177639.1.90115 WP_001177639.1.90128 WP_001177639.1.90146 WP_001177639.1.90156 WP_001177639.1.90168 WP_001177639.1.90171 WP_001177639.1.90182 WP_001177639.1.902 WP_001177639.1.90249 WP_001177639.1.90256 WP_001177639.1.90266 WP_001177639.1.90270 WP_001177639.1.90314 WP_001177639.1.90315 WP_001177639.1.90346 WP_001177639.1.90349 WP_001177639.1.90357 WP_001177639.1.90358 WP_001177639.1.9036 WP_001177639.1.9037 WP_001177639.1.90405 WP_001177639.1.90435 WP_001177639.1.90436 WP_001177639.1.90449 WP_001177639.1.90467 WP_001177639.1.90511 WP_001177639.1.90525 WP_001177639.1.90536 WP_001177639.1.90542 WP_001177639.1.90602 WP_001177639.1.9061 WP_001177639.1.90626 WP_001177639.1.90690 WP_001177639.1.90706 WP_001177639.1.90758 WP_001177639.1.90775 WP_001177639.1.90813 WP_001177639.1.90828 WP_001177639.1.90834 WP_001177639.1.90837 WP_001177639.1.9084 WP_001177639.1.90844 WP_001177639.1.90848 WP_001177639.1.90856 WP_001177639.1.90864 WP_001177639.1.90865 WP_001177639.1.9087 WP_001177639.1.90873 WP_001177639.1.90890 WP_001177639.1.909 WP_001177639.1.90905 WP_001177639.1.90951 WP_001177639.1.90967 WP_001177639.1.90979 WP_001177639.1.9098 WP_001177639.1.90988 WP_001177639.1.90996 WP_001177639.1.90997 WP_001177639.1.91007 WP_001177639.1.91010 WP_001177639.1.91018 WP_001177639.1.9104 WP_001177639.1.91088 WP_001177639.1.91094 WP_001177639.1.91113 WP_001177639.1.91117 WP_001177639.1.91121 WP_001177639.1.91138 WP_001177639.1.91143 WP_001177639.1.91153 WP_001177639.1.9118 WP_001177639.1.91182 WP_001177639.1.9119 WP_001177639.1.91213 WP_001177639.1.91220 WP_001177639.1.91266 WP_001177639.1.91277 WP_001177639.1.91288 WP_001177639.1.91290 WP_001177639.1.91340 WP_001177639.1.91341 WP_001177639.1.91354 WP_001177639.1.91356 WP_001177639.1.91361 WP_001177639.1.91377 WP_001177639.1.91384 WP_001177639.1.91397 WP_001177639.1.91414 WP_001177639.1.91425 WP_001177639.1.91445 WP_001177639.1.91462 WP_001177639.1.91482 WP_001177639.1.91485 WP_001177639.1.91494 WP_001177639.1.915 WP_001177639.1.91511 WP_001177639.1.91515 WP_001177639.1.91526 WP_001177639.1.91543 WP_001177639.1.91548 WP_001177639.1.91549 WP_001177639.1.91551 WP_001177639.1.91565 WP_001177639.1.91566 WP_001177639.1.9157 WP_001177639.1.91594 WP_001177639.1.91596 WP_001177639.1.9160 WP_001177639.1.91626 WP_001177639.1.91630 WP_001177639.1.91640 WP_001177639.1.91666 WP_001177639.1.9168 WP_001177639.1.9169 WP_001177639.1.91701 WP_001177639.1.9171 WP_001177639.1.91739 WP_001177639.1.91756 WP_001177639.1.91779 WP_001177639.1.91782 WP_001177639.1.91793 WP_001177639.1.91814 WP_001177639.1.91843 WP_001177639.1.91850 WP_001177639.1.91863 WP_001177639.1.91879 WP_001177639.1.91887 WP_001177639.1.91893 WP_001177639.1.91894 WP_001177639.1.91954 WP_001177639.1.91959 WP_001177639.1.91965 WP_001177639.1.91971 WP_001177639.1.9199 WP_001177639.1.91994 WP_001177639.1.92005 WP_001177639.1.92025 WP_001177639.1.92029 WP_001177639.1.92031 WP_001177639.1.92048 WP_001177639.1.92053 WP_001177639.1.92058 WP_001177639.1.9209 WP_001177639.1.92096 WP_001177639.1.921 WP_001177639.1.92102 WP_001177639.1.92114 WP_001177639.1.92123 WP_001177639.1.9215 WP_001177639.1.92161 WP_001177639.1.92163 WP_001177639.1.92195 WP_001177639.1.92201 WP_001177639.1.92215 WP_001177639.1.92276 WP_001177639.1.92295 WP_001177639.1.92304 WP_001177639.1.92305 WP_001177639.1.92361 WP_001177639.1.92384 WP_001177639.1.924 WP_001177639.1.92403 WP_001177639.1.92434 WP_001177639.1.92462 WP_001177639.1.92473 WP_001177639.1.92495 WP_001177639.1.92496 WP_001177639.1.92506 WP_001177639.1.92535 WP_001177639.1.9255 WP_001177639.1.92568 WP_001177639.1.92571 WP_001177639.1.92614 WP_001177639.1.92615 WP_001177639.1.92634 WP_001177639.1.92638 WP_001177639.1.9264 WP_001177639.1.92648 WP_001177639.1.92693 WP_001177639.1.92708 WP_001177639.1.92719 WP_001177639.1.92742 WP_001177639.1.92750 WP_001177639.1.92767 WP_001177639.1.92780 WP_001177639.1.92781 WP_001177639.1.92792 WP_001177639.1.92793 WP_001177639.1.92796 WP_001177639.1.92819 WP_001177639.1.92845 WP_001177639.1.92865 WP_001177639.1.92882 WP_001177639.1.92886 WP_001177639.1.92932 WP_001177639.1.92943 WP_001177639.1.92991 WP_001177639.1.93005 WP_001177639.1.93017 WP_001177639.1.93019 WP_001177639.1.93033 WP_001177639.1.93048 WP_001177639.1.93052 WP_001177639.1.93054 WP_001177639.1.93069 WP_001177639.1.93085 WP_001177639.1.93100 WP_001177639.1.93112 WP_001177639.1.93133 WP_001177639.1.93138 WP_001177639.1.93139 WP_001177639.1.93150 WP_001177639.1.93167 WP_001177639.1.93175 WP_001177639.1.93185 WP_001177639.1.93267 WP_001177639.1.9327 WP_001177639.1.93276 WP_001177639.1.93291 WP_001177639.1.9331 WP_001177639.1.93312 WP_001177639.1.93326 WP_001177639.1.93338 WP_001177639.1.93379 WP_001177639.1.934 WP_001177639.1.93427 WP_001177639.1.93428 WP_001177639.1.93461 WP_001177639.1.93463 WP_001177639.1.93464 WP_001177639.1.93468 WP_001177639.1.93531 WP_001177639.1.93533 WP_001177639.1.93552 WP_001177639.1.9356 WP_001177639.1.93569 WP_001177639.1.93605 WP_001177639.1.93626 WP_001177639.1.93629 WP_001177639.1.93637 WP_001177639.1.93639 WP_001177639.1.93652 WP_001177639.1.93665 WP_001177639.1.93670 WP_001177639.1.93673 WP_001177639.1.93679 WP_001177639.1.93694 WP_001177639.1.93695 WP_001177639.1.93716 WP_001177639.1.93733 WP_001177639.1.93737 WP_001177639.1.93742 WP_001177639.1.93745 WP_001177639.1.93755 WP_001177639.1.93765 WP_001177639.1.938 WP_001177639.1.93800 WP_001177639.1.93821 WP_001177639.1.93870 WP_001177639.1.939 WP_001177639.1.93900 WP_001177639.1.93911 WP_001177639.1.93921 WP_001177639.1.93922 WP_001177639.1.93939 WP_001177639.1.93951 WP_001177639.1.94025 WP_001177639.1.94028 WP_001177639.1.94035 WP_001177639.1.94040 WP_001177639.1.94057 WP_001177639.1.94069 WP_001177639.1.9416 WP_001177639.1.94176 WP_001177639.1.94190 WP_001177639.1.9420 WP_001177639.1.94232 WP_001177639.1.9426 WP_001177639.1.94271 WP_001177639.1.94282 WP_001177639.1.94298 WP_001177639.1.94302 WP_001177639.1.94317 WP_001177639.1.94343 WP_001177639.1.94353 WP_001177639.1.94367 WP_001177639.1.94388 WP_001177639.1.94404 WP_001177639.1.94417 WP_001177639.1.94429 WP_001177639.1.94430 WP_001177639.1.94436 WP_001177639.1.94438 WP_001177639.1.94446 WP_001177639.1.94468 WP_001177639.1.94475 WP_001177639.1.94497 WP_001177639.1.94507 WP_001177639.1.94516 WP_001177639.1.94523 WP_001177639.1.94544 WP_001177639.1.94548 WP_001177639.1.9457 WP_001177639.1.94580 WP_001177639.1.94589 WP_001177639.1.94619 WP_001177639.1.94646 WP_001177639.1.94653 WP_001177639.1.94676 WP_001177639.1.94686 WP_001177639.1.94690 WP_001177639.1.94695 WP_001177639.1.94704 WP_001177639.1.94727 WP_001177639.1.94738 WP_001177639.1.94739 WP_001177639.1.9474 WP_001177639.1.94753 WP_001177639.1.94754 WP_001177639.1.94764 WP_001177639.1.94787 WP_001177639.1.948 WP_001177639.1.94801 WP_001177639.1.94806 WP_001177639.1.94808 WP_001177639.1.94822 WP_001177639.1.94823 WP_001177639.1.94836 WP_001177639.1.94841 WP_001177639.1.94847 WP_001177639.1.94869 WP_001177639.1.94877 WP_001177639.1.94880 WP_001177639.1.9489 WP_001177639.1.94892 WP_001177639.1.949 WP_001177639.1.94903 WP_001177639.1.94907 WP_001177639.1.9491 WP_001177639.1.94927 WP_001177639.1.94935 WP_001177639.1.94949 WP_001177639.1.94955 WP_001177639.1.94963 WP_001177639.1.94991 WP_001177639.1.94997 WP_001177639.1.95005 WP_001177639.1.95011 WP_001177639.1.95022 WP_001177639.1.95028 WP_001177639.1.95035 WP_001177639.1.95036 WP_001177639.1.95037 WP_001177639.1.95062 WP_001177639.1.95080 WP_001177639.1.95084 WP_001177639.1.95105 WP_001177639.1.9513 WP_001177639.1.95161 WP_001177639.1.95198 WP_001177639.1.95233 WP_001177639.1.95243 WP_001177639.1.95244 WP_001177639.1.95254 WP_001177639.1.95275 WP_001177639.1.95310 WP_001177639.1.95329 WP_001177639.1.95332 WP_001177639.1.95364 WP_001177639.1.95366 WP_001177639.1.95378 WP_001177639.1.95398 WP_001177639.1.95403 WP_001177639.1.95428 WP_001177639.1.95431 WP_001177639.1.95449 WP_001177639.1.95563 WP_001177639.1.9559 WP_001177639.1.95595 WP_001177639.1.95596 WP_001177639.1.95604 WP_001177639.1.95628 WP_001177639.1.95634 WP_001177639.1.95655 WP_001177639.1.9566 WP_001177639.1.95666 WP_001177639.1.95680 WP_001177639.1.95712 WP_001177639.1.95756 WP_001177639.1.95759 WP_001177639.1.95783 WP_001177639.1.95821 WP_001177639.1.95827 WP_001177639.1.95835 WP_001177639.1.95846 WP_001177639.1.95849 WP_001177639.1.95858 WP_001177639.1.95861 WP_001177639.1.95865 WP_001177639.1.95869 WP_001177639.1.95916 WP_001177639.1.95929 WP_001177639.1.95931 WP_001177639.1.95932 WP_001177639.1.95951 WP_001177639.1.96032 WP_001177639.1.96059 WP_001177639.1.96086 WP_001177639.1.96097 WP_001177639.1.96110 WP_001177639.1.96114 WP_001177639.1.96128 WP_001177639.1.96143 WP_001177639.1.96145 WP_001177639.1.9616 WP_001177639.1.96215 WP_001177639.1.96223 WP_001177639.1.96229 WP_001177639.1.96247 WP_001177639.1.96253 WP_001177639.1.96293 WP_001177639.1.96299 WP_001177639.1.96303 WP_001177639.1.96339 WP_001177639.1.96341 WP_001177639.1.96378 WP_001177639.1.96392 WP_001177639.1.96394 WP_001177639.1.9641 WP_001177639.1.96417 WP_001177639.1.96420 WP_001177639.1.96450 WP_001177639.1.96457 WP_001177639.1.96478 WP_001177639.1.96480 WP_001177639.1.96484 WP_001177639.1.9649 WP_001177639.1.96519 WP_001177639.1.96541 WP_001177639.1.96558 WP_001177639.1.96562 WP_001177639.1.96585 WP_001177639.1.96608 WP_001177639.1.96609 WP_001177639.1.9661 WP_001177639.1.96633 WP_001177639.1.96650 WP_001177639.1.96676 WP_001177639.1.9668 WP_001177639.1.96680 WP_001177639.1.96683 WP_001177639.1.96695 WP_001177639.1.96701 WP_001177639.1.9671 WP_001177639.1.96725 WP_001177639.1.96743 WP_001177639.1.96753 WP_001177639.1.96759 WP_001177639.1.96762 WP_001177639.1.96769 WP_001177639.1.96779 WP_001177639.1.96796 WP_001177639.1.96797 WP_001177639.1.96817 WP_001177639.1.9682 WP_001177639.1.96820 WP_001177639.1.96850 WP_001177639.1.96864 WP_001177639.1.96894 WP_001177639.1.96907 WP_001177639.1.96924 WP_001177639.1.96932 WP_001177639.1.96944 WP_001177639.1.96971 WP_001177639.1.96989 WP_001177639.1.97011 WP_001177639.1.9708 WP_001177639.1.97119 WP_001177639.1.97123 WP_001177639.1.97147 WP_001177639.1.97170 WP_001177639.1.97195 WP_001177639.1.97226 WP_001177639.1.9723 WP_001177639.1.97231 WP_001177639.1.97247 WP_001177639.1.97248 WP_001177639.1.97269 WP_001177639.1.97279 WP_001177639.1.97282 WP_001177639.1.9729 WP_001177639.1.97292 WP_001177639.1.97344 WP_001177639.1.97351 WP_001177639.1.97360 WP_001177639.1.97361 WP_001177639.1.97379 WP_001177639.1.97387 WP_001177639.1.9740 WP_001177639.1.97418 WP_001177639.1.97434 WP_001177639.1.97437 WP_001177639.1.97439 WP_001177639.1.97459 WP_001177639.1.97464 WP_001177639.1.97502 WP_001177639.1.97513 WP_001177639.1.97525 WP_001177639.1.97527 WP_001177639.1.97544 WP_001177639.1.97549 WP_001177639.1.97560 WP_001177639.1.97571 WP_001177639.1.97619 WP_001177639.1.97632 WP_001177639.1.97654 WP_001177639.1.97667 WP_001177639.1.97675 WP_001177639.1.97685 WP_001177639.1.97711 WP_001177639.1.97770 WP_001177639.1.97775 WP_001177639.1.97778 WP_001177639.1.97789 WP_001177639.1.97798 WP_001177639.1.978 WP_001177639.1.97802 WP_001177639.1.97815 WP_001177639.1.97822 WP_001177639.1.97823 WP_001177639.1.97825 WP_001177639.1.97890 WP_001177639.1.97895 WP_001177639.1.97919 WP_001177639.1.97930 WP_001177639.1.97932 WP_001177639.1.97937 WP_001177639.1.97962 WP_001177639.1.97982 WP_001177639.1.97996 WP_001177639.1.98000 WP_001177639.1.98005 WP_001177639.1.98026 WP_001177639.1.98102 WP_001177639.1.98115 WP_001177639.1.98139 WP_001177639.1.98155 WP_001177639.1.9816 WP_001177639.1.98167 WP_001177639.1.9817 WP_001177639.1.98176 WP_001177639.1.98187 WP_001177639.1.98202 WP_001177639.1.98205 WP_001177639.1.98208 WP_001177639.1.98220 WP_001177639.1.98232 WP_001177639.1.98235 WP_001177639.1.98239 WP_001177639.1.98244 WP_001177639.1.98251 WP_001177639.1.98279 WP_001177639.1.98284 WP_001177639.1.98292 WP_001177639.1.98294 WP_001177639.1.98301 WP_001177639.1.98323 WP_001177639.1.98355 WP_001177639.1.98357 WP_001177639.1.98400 WP_001177639.1.98404 WP_001177639.1.98424 WP_001177639.1.98429 WP_001177639.1.9844 WP_001177639.1.98466 WP_001177639.1.98477 WP_001177639.1.98480 WP_001177639.1.98484 WP_001177639.1.98498 WP_001177639.1.98543 WP_001177639.1.98549 WP_001177639.1.98569 WP_001177639.1.98578 WP_001177639.1.9858 WP_001177639.1.98587 WP_001177639.1.98603 WP_001177639.1.98614 WP_001177639.1.98626 WP_001177639.1.98628 WP_001177639.1.98633 WP_001177639.1.9864 WP_001177639.1.98641 WP_001177639.1.98665 WP_001177639.1.98668 WP_001177639.1.98683 WP_001177639.1.98727 WP_001177639.1.98757 WP_001177639.1.98775 WP_001177639.1.98776 WP_001177639.1.98784 WP_001177639.1.98795 WP_001177639.1.98849 WP_001177639.1.98886 WP_001177639.1.98908 WP_001177639.1.98976 WP_001177639.1.98988 WP_001177639.1.99006 WP_001177639.1.99029 WP_001177639.1.99046 WP_001177639.1.99053 WP_001177639.1.99060 WP_001177639.1.9907 WP_001177639.1.99110 WP_001177639.1.99119 WP_001177639.1.99168 WP_001177639.1.99182 WP_001177639.1.99246 WP_001177639.1.99265 WP_001177639.1.99289 WP_001177639.1.99292 WP_001177639.1.99295 WP_001177639.1.9930 WP_001177639.1.99302 WP_001177639.1.99304 WP_001177639.1.99306 WP_001177639.1.99307 WP_001177639.1.99310 WP_001177639.1.99319 WP_001177639.1.99334 WP_001177639.1.99349 WP_001177639.1.9935 WP_001177639.1.99361 WP_001177639.1.99366 WP_001177639.1.99401 WP_001177639.1.99427 WP_001177639.1.99453 WP_001177639.1.99458 WP_001177639.1.99471 WP_001177639.1.99472 WP_001177639.1.99486 WP_001177639.1.99487 WP_001177639.1.99498 WP_001177639.1.9950 WP_001177639.1.99501 WP_001177639.1.99511 WP_001177639.1.99534 WP_001177639.1.99549 WP_001177639.1.99562 WP_001177639.1.99571 WP_001177639.1.99592 WP_001177639.1.99602 WP_001177639.1.99632 WP_001177639.1.99641 WP_001177639.1.99666 WP_001177639.1.99692 WP_001177639.1.99694 WP_001177639.1.99698 WP_001177639.1.99734 WP_001177639.1.99771 WP_001177639.1.99774 WP_001177639.1.99782 WP_001177639.1.99791 WP_001177639.1.99869 WP_001177639.1.99874 WP_001177639.1.99892 WP_001177639.1.99912 WP_001177639.1.99929 WP_001177639.1.99986 YP_002410504.1.10275 YP_002415308.1.14968 YP_006122588.1.29421 YP_006781207.1.12065 YP_405789.1.10455 gi|82546581|ref|YP_410528.1| gi|170680746|ref|YP_001746573.1| gi|384545853|ref|YP_005729917.1| gi|387610060|ref|YP_006098916.1| gi|218561337|ref|YP_002394250.1| gi|110808096|ref|YP_691616.1| gi|238903285|ref|YP_002929081.1| gi|387885398|ref|YP_006315700.1| gi|218707789|ref|YP_002415308.1| gi|388480125|ref|YP_492320.1| gi|471335648|ref|YP_007559125.1| gi|15834408|ref|NP_313181.1| gi|110644535|ref|YP_672265.1| gi|386602240|ref|YP_006103746.1| gi|218697927|ref|YP_002405594.1| gi|170083624|ref|YP_001732944.1| gi|218702875|ref|YP_002410504.1| gi|387832117|ref|YP_003352054.1| gi|260847008|ref|YP_003224786.1| gi|386617086|ref|YP_006136752.1| gi|26251070|ref|NP_757110.1| gi|383181508|ref|YP_005459513.1| gi|386627141|ref|YP_006146869.1| gi|410484600|ref|YP_006772146.1| gi|222158943|ref|YP_002559082.1| gi|544578818|ref|YP_008574342.1| gi|30065550|ref|NP_839721.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]