SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000023 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000023
Domain Number 1 Region: 148-219,266-532
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.82e-93
Family NadC C-terminal domain-like 0.0000148
Further Details:      
 
Domain Number 2 Region: 15-153
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 4.54e-35
Family NadC N-terminal domain-like 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000023   Gene: ENSSTOG00000000024   Transcript: ENSSTOT00000000024
Sequence length 538
Comment pep:known_by_projection scaffold:spetri2:JH393280.1:8554754:8557827:1 gene:ENSSTOG00000000024 transcript:ENSSTOT00000000024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEWDAEGRAAARPLLTDYYQATMALGYWRAGRALDPAEFELFFRRCPFGGSFVLAAGL
RDCMRFLRTFRLLDADVQFLASMLPPDTDPAFFKHLRALDCSGVTVRALPEGSLAFPGVP
LLQVSGPLLLVQLLETPLLCLVSYASLVATNAARLRLIAGPDKRLLELGLRRAQGPDGGL
TASTYSYLGGFDSSSNVLAGQLRGVPMAGTLAHSFITSFSGNEVPPDPMLAPAAGKGPRV
DLVARVKLWLERVCAHLGLGLQEPHLGEQAAFVAYALAFPRAFQGLLDTYSVRRSGLPNF
LAVALALGELGYRAVGVRLDSGDLLQQAQEIRRVFRTTAAQFQVPWLEAVPIAVSNNIDE
KELARLAQEGSEVNVIGIGTSVVTCPQQPSLGCVYKLVSVGGQPRMKLTEDPEKQTLPGS
KAAFRLLGSDGSLLMDLLQLAEEPPPQAGQELRVWPRGAQEPCTVRPAQVEPLLRLWLRL
GELCEPLPSLSESRAFAQQSLSRLSPAHRRLQSPALYQVALSEKLRALVDSLSAGGLL
Download sequence
Identical sequences I3LVU9
ENSSTOP00000000023 ENSSTOP00000000023 XP_005316152.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]