SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000235 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000235
Domain Number 1 Region: 264-378,498-644
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.41e-65
Family Phosphate binding protein-like 0.00000000125
Further Details:      
 
Domain Number 2 Region: 5-252
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.73e-38
Family L-arabinose binding protein-like 0.017
Further Details:      
 
Domain Number 3 Region: 395-497
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000131
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000235   Gene: ENSSTOG00000000265   Transcript: ENSSTOT00000000265
Sequence length 751
Comment pep:known_by_projection scaffold:spetri2:JH393361.1:2427726:2526119:-1 gene:ENSSTOG00000000265 transcript:ENSSTOT00000000265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRFFFALNTEIGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVI
DCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPM
VTKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDC
LANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWN
DMDKLVLIQDVPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLA
SEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVI
DFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPY
EWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFT
LIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEK
MWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDS
KGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSL
SNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKLTFSEAIRNKARLSITGSVGENG
RVLTPDCPKAVHTGTAIRQSSGLAVIASDLP
Download sequence
Identical sequences ENSSTOP00000000235 ENSSTOP00000000235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]