SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000237 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000237
Domain Number 1 Region: 18-117
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 5.89e-25
Family 4'-Phosphopantetheinyl transferase SFP 0.0069
Further Details:      
 
Domain Number 2 Region: 125-250
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 2.22e-23
Family 4'-Phosphopantetheinyl transferase SFP 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000237   Gene: ENSSTOG00000000268   Transcript: ENSSTOT00000000267
Sequence length 309
Comment pep:known_by_projection scaffold:spetri2:JH393361.1:2314227:2335662:-1 gene:ENSSTOG00000000268 transcript:ENSSTOT00000000267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAA
MAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSLNPYPNFNFNISHQGDYAVLAA
EPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALK
ESFIKAIGVGLGFELQRLEFDISPLNLDIGEVYKETRLFLDGEEEKEWAFEESKIDEHHF
VAVALRKPNGSRHEDVSSQDDSIPTQRQFTILTFNDLISSAVPMTPEDPSFWDCFCFTEE
IPIRNGTKS
Download sequence
Identical sequences I3LW98
ENSSTOP00000000237 ENSSTOP00000000237 XP_005329134.1.77405 XP_015345412.1.40921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]