SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000260 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000260
Domain Number 1 Region: 11-497
Classification Level Classification E-value
Superfamily ALDH-like 4.19e-185
Family ALDH-like 0.0000000000000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000260   Gene: ENSSTOG00000000292   Transcript: ENSSTOT00000000291
Sequence length 502
Comment pep:known_by_projection scaffold:spetri2:JH393281.1:19177711:19225544:-1 gene:ENSSTOG00000000292 transcript:ENSSTOT00000000291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTELKIFLNCPEKLKMFKIWYLEIFINNEWQNSESGRVFPVYNPATGEQICEVQEADKAD
IDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAFLATMESLNGGKPFLQAF
YVDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWK
IAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINIVPGYGPTAGAAIASHIGI
DKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQ
GQCCTAGSRIFVEESIYEEFVRRSVERAKRRIVGSPFDPTTEQGPQIDKKQYNKILELIQ
SGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIE
RANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMG
EFGLREYSEVKTVTVKIPQKNS
Download sequence
Identical sequences ENSSTOP00000000260 ENSSTOP00000000260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]