SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000350 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000350
Domain Number 1 Region: 44-283
Classification Level Classification E-value
Superfamily PLP-binding barrel 9.35e-73
Family Alanine racemase-like, N-terminal domain 0.000000000759
Further Details:      
 
Domain Number 2 Region: 267-417
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 6.7e-49
Family Eukaryotic ODC-like 0.000000306
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000350   Gene: ENSSTOG00000000386   Transcript: ENSSTOT00000000387
Sequence length 461
Comment pep:novel scaffold:spetri2:JH393342.1:6581944:6586780:-1 gene:ENSSTOG00000000386 transcript:ENSSTOT00000000387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNFSNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALP
RVTPFYAVKCNDSRAIVKTLAAIGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI
KYAASIGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLKTSRLL
LERAKELNIDVIGVSFHVGSGCTDPETFVQAISDARCVFDMGAEAGFSMRLLDIGGGFPG
SEDVKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKLVLKEQ
TGSDDEDEASEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTC
DGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPTWQCMQQI
QNHGFPPEVEEQDVGTLPVSCAQESSMKRHPAACASTSINV
Download sequence
Identical sequences I3LWJ0
XP_005327413.1.77405 ENSSTOP00000000350 ENSSTOP00000000350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]