SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000411 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000411
Domain Number 1 Region: 184-250
Classification Level Classification E-value
Superfamily FnI-like domain 1.76e-16
Family VWC domain 0.0051
Further Details:      
 
Domain Number 2 Region: 43-110
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000209
Family VWC domain 0.023
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000000411
Domain Number - Region: 2-31
Classification Level Classification E-value
Superfamily FnI-like domain 0.00806
Family VWC domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000411   Gene: ENSSTOG00000000457   Transcript: ENSSTOT00000000457
Sequence length 386
Comment pep:known_by_projection scaffold:spetri2:JH393308.1:3637485:3653581:-1 gene:ENSSTOG00000000457 transcript:ENSSTOT00000000457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQVSCYRLHCPPVHCPQPVTEPQQCCPRCVEPHTPSGLRAPPKSCQHNGTMYQHGEIFTA
RELFPTRLPNQCVLCSCTEGQIYCGLATCPEPGCPAPLPLPASCCQACKGDGAEQERESE
PCSSCHLQRRSQDPCLGDGGKKKGPGTPAPTGPSSPRGFIPRHFRPKGAGSTTVKIVLKE
KHKKACVHGGKTYSHGEVWHPAFRSFGPLPCILCTCQDGHQDCQRVTCPTEYPCHHPEKV
AGKCCKICPEDKADPGHSEISSTRCPTAPSRVLVHTSVSPSPDTLHRFALEHEASDQVEI
YLWKLVKDEETEAQRGEVPGPRPHSQNLPLDSDQESQEARLPERGTELPAAHQHPGRSLE
RLPSPDSRTEGHSQSRQSDQDLITKI
Download sequence
Identical sequences ENSSTOP00000000411 ENSSTOP00000000411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]