SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000467 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000467
Domain Number 1 Region: 16-372
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.06e-70
Family L-arabinose binding protein-like 0.0011
Further Details:      
 
Domain Number 2 Region: 392-506,625-765
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.85e-65
Family Phosphate binding protein-like 0.00000000116
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000000467
Domain Number - Region: 517-620
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000981
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000467   Gene: ENSSTOG00000000510   Transcript: ENSSTOT00000000517
Sequence length 896
Comment pep:known_by_projection scaffold:spetri2:JH393310.1:12387630:12536245:1 gene:ENSSTOG00000000510 transcript:ENSSTOT00000000517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGIFETVENEPVNVEELAFKFAVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQ
LALGVAALFGPSHSSSVSAVQSICNALEVPHIQTRWKHPSVDNKDLFYINLYPDYAAISR
AVLDLVLYYNWKTVTVVYEDSTGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEM
KKGKEFYVIFDCSHETAAEILKQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTG
FRLLNIDNPHVSSIIEKWSMERLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRAS
QLTVSSLQCHRHKPWRLGPRFMNLIKEARWDGLTGRITFNKTDGLRKDFDLDIISLKEEG
TEKIGIWNSNSGLNMTDGNKDRSNNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDR
FEGYCLDLLKELSNILGFLYDVKLVADGKYGAQNDKGEWNGMVKELIDHKADLAVAPLTI
TYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLF
VIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGI
WWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSRI
STYEKMWAFMSSRQQTALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLI
DSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDSKEASALGVEN
IGGIFIVLAAGLVLSVFVAIGEFIYKSRKNNDIEQQKGKSSRLRFYFRNKVRFHGRKKQS
LGVEKCLSFNAIMEELGISLKNQKKLKKKSRTKGKSSFTSILTCHQRRTQRKETVA
Download sequence
Identical sequences ENSSTOP00000000467 ENSSTOP00000000467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]