SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000607 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000607
Domain Number 1 Region: 283-738
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 8.63e-49
Family Quinoprotein alcohol dehydrogenase-like 0.024
Further Details:      
 
Domain Number 2 Region: 43-203,262-399
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.84e-40
Family WD40-repeat 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000607   Gene: ENSSTOG00000000672   Transcript: ENSSTOT00000000677
Sequence length 1509
Comment pep:known_by_projection scaffold:spetri2:JH393281.1:5080795:5133786:1 gene:ENSSTOG00000000672 transcript:ENSSTOT00000000677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVEGSTITSRIKNLLRSPSIKLRRSKAGNRREDLSSKVTLEKVLGITVSGGRGLACDPR
SGLVAYPAGCVVVLFNPRKHKQHHILNSSRKTITALAFSPDGKYLVTGESGHMPAVRVWD
VAEHSQVAELQEHKYGVACVAFSPSAKYIVSVGYQHDMIVNVWAWKKNIVVASNKVSSRV
TAVSFSEDCSYFVTAGNRHIKFWYLDDSKTSKVNATVPLLGRSGLLGELRNNLFTDVACG
RGKKADSTFCITSSGLLCEFSDRRLLDKWVELRNTDSFTTTVAHCISVSQDYIFCGCADG
TVRLFNPSNLHFLSTLPRPHALGTDIASITEASRLFSGGANARYPDTIALTFDPTNQWLS
CVYNDHSIYVWDVRDPKKVGKVYSALYHSSCVWSVEVYPEVKDSNQACLPPSSFITCSSD
NTIRLWNTESSGVHGSTLHRNILSNDLIKIIYVDGNTQALLDTEMPGGDKADGSLMDPRV
GIRSVCISPNGQHLASGDRMGTLRVHELQSLSEMLKVEAHDSEILCLEYSKPDTGLKLLA
SASRDRLIHVLDAGREYSLQQTLDEHSSSITAVKFAASDGQVRMISCGADKSIYFRTAQK
SGDGVHFTRTHHVVRKTTLYDMDVEPSWKYTAIGCQDRNIRIFNISSGKQKKLFKGSQGE
DGTLIKVQTDPSGIYIATSCSDKNLSIFDFSSGECVATMFGHSEIVTGMKFSNDCKHLIS
VSGDSCIFVWRLSSEMTISMRQRLAELRQRQRGGKQQEPTSPQRASGPNRPQTPVMLSSG
PALSSDSDKEGEDEGTEEEELPALPILAKSTKKEPASVPSPALSRSLSHWEMSRAQETVE
FLDPAPVANSGPRRRGRWAQPGVELSVCSMLDLRQLETLTPSPQGHCQDSLAMTPSGPGK
HGQKAPVTSHASQNEKSPQLQASQPCSCPHLIRFLSQEEGVFAQDLEAAPSEDGIVYPEP
SDSPTMDTRQGEFQVQAPTRGTLGRVYPSSRGSEKHSPDSACSVDYSSSRLSSPEHPNED
SESTEPLSVDGISSDLEEPAEGDEEEEEEEGGTGPYELQEGSPHTPDQEQFLKQHFETLA
NGAAPGAPVRVPERTESQSISSRFLLQAQTPPLRDPSSSSLALMSRHIQVSQVSGEQQRG
SDANPPGAPPEVEPSPANPSPHQAAPVLLPRRRHNLDSSWAPKRVITAGFSAGLQKAQSV
HSLVPQANEMPSSGPLLSRDMEVQDGLDSLPQVDGRPSWPYSYQNPTTSSMAKISRSISV
GENLGLMAETQAPVSIRNSPLSKLALPSRAHLVLDIPKPLPDRPTLATFSPVTKGWAPDD
AEQAGSPAGLGKAHSTSERRACLGEGTAPKPRMECQAQPGPNRPSAQQLPVSLLRSPENL
QPPPPERTPNPMECIRPGAALSQNSELVVSLEQCEKLVAELRGNVHQAVQLYHSVAGCKT
PSAEQSRITQLLRDTFSSVRQELEALPGAALSSPSGSPGAVGAEQTQALLEQYSELLLRA
VEQRMERRL
Download sequence
Identical sequences ENSSTOP00000000607 ENSSTOP00000000607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]