SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000969 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000969
Domain Number 1 Region: 224-385,450-512
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-39
Family Voltage-gated potassium channels 0.0049
Further Details:      
 
Domain Number 2 Region: 515-699
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-35
Family cAMP-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 41-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.66e-21
Family Flavin-binding PAS domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000969   Gene: ENSSTOG00000001084   Transcript: ENSSTOT00000001085
Sequence length 1088
Comment pep:known_by_projection scaffold:spetri2:JH393322.1:7259857:7277416:1 gene:ENSSTOG00000001084 transcript:ENSSTOT00000001085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAMRGLLAPQNTFLDTIATRFDGTHSNFVLGNAQVAGLFPVVYCSDGFCDLTGFSRAEV
MQRGCACSFLYGPDTSELVRQQIRKALDEHKEFKAELILYRKSGLPFWCLLDVIPIKNEK
GEVALFLVSHKDISDTKNRGGPDSWKETGGGRRRYGRAGAKGFNANRRRSRAVLYHLSGH
LQKQPKGKHKLNKGVFGEKPNLPEYKVAAIRKSPFILLHCGALRATWDGFILLATLYVAV
TVPYSVCVSTAREPSAARGPPSVCDLAVEVLFILDIVLNFRTTFVSKSGQVVFAPKSICL
HYVTTWFLLDVIAALPFDLLHAFKVNVYFGAHLLKTVRLLRLLRLLPRLDRYSQYSAVVL
TLLMAVFALLAHWVACIWFYIGQQEIESSESELPEIGWLQELARRLETPYYLVGKKPVGE
NSSGQNDNCSSSSSSSSSEANGTGLELLGGPSLRSAYITSLYFALSSLTSVGFGNVSANT
DTEKIFSICTMLIGALMHAVVFGNVTAIIQRMYARRFLYHSRTRDLRDYIRIHRIPKPLK
QRMLEYFQATWAVNNGIDTTELLQSLPDELRADIAMHLHKEVLQLPLFEAASRGCLRALS
LALRPAFCTPGEYLIHQGDALQALYFVCSGSMEVLKGGTVLAILGKGDLIGCELPQREQV
VKANADVKGLTYCVLQCLQLAGLHDSLALYPEFAPRFSRGLRGELSYNLGSGGGPAEVDT
SSLSGDNTLMSTLEEKETDGEQGPTASPATADEPSSPLLSPGCTSSSSAAKLLSPRRTAP
RPRLGGRGRPSRARALKAEASASAHPRTLEGLRLPPMPWNVPPDLSPRVVDGIEDGCGSD
QHKFSFRVGQPGLECSSSPSPGPESGLLTVPLGPSEARNTDTLDKLRQAVMELSEQVLQM
REGLQSLRQAVQLVLVPHGEGPCPRASGEGPCRGTVSASGLLQPLRVDTGTSSYLQPPVG
SVLSGTWPHPRPGPPPLMAPWPWGPPASQSSPWPRATTLWTSTSDSEPPGSGELCSEPST
PASLPPEEGAGTGPPEPVSQAETTSTGEPPPGSGSRALPWDPHSLEMVLIGCHGPGTVQW
TQEEGTGV
Download sequence
Identical sequences I3LXY1
XP_005324974.1.77405 ENSSTOP00000000969 ENSSTOP00000000969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]