SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001004 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001004
Domain Number 1 Region: 5-130
Classification Level Classification E-value
Superfamily PapD-like 4.97e-41
Family MSP-like 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000001004
Domain Number - Region: 164-194
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0432
Family RILP dimerisation region 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001004   Gene: ENSSTOG00000001129   Transcript: ENSSTOT00000001124
Sequence length 243
Comment pep:known_by_projection scaffold:spetri2:JH393340.1:985580:1029124:1 gene:ENSSTOG00000001129 transcript:ENSSTOT00000001124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGI
IDAGASVNVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLR
CVFELPAENDKPHDVEINKIISTTASKTEAPSVSKSLTTSLDDSEVKKVLEECKRLQGEV
QRLREENKQFKEEDGLRMRKTVPSNSPIAALAATGKEEGLSTRLLALVVLFFIVGVIVGK
IAL
Download sequence
Identical sequences I3LY06
ENSSTOP00000001004 ENSSTOP00000001004 XP_005327138.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]