SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001029 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001029
Domain Number 1 Region: 81-258
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.62e-22
Family TrmB-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001029   Gene: ENSSTOG00000001154   Transcript: ENSSTOT00000001151
Sequence length 265
Comment pep:known_by_projection scaffold:spetri2:JH393456.1:1905774:1908460:-1 gene:ENSSTOG00000001154 transcript:ENSSTOT00000001151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTETGNPVGAEAPQPQKRYYRQRAHSNPMADHTLRYPVKPEDMDWSELYPEFFAPLTQ
NQSHDDPKDKKENRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDR
IRALRTAPGGGFQNIACLRSNAMKHLPNFFRKGQLTKMFFLFPDPHFKRTKHKWRIISPT
LLAEYAYVLRVGGLVYTITDVLELHHWMCTHFEGHPLFERVPLEELSEDPIIRHLGTSTE
EGKKVLRNGGKNFPAIFRRIQDPAL
Download sequence
Identical sequences A0A287DFX4
ENSSTOP00000001029 XP_005335761.2.77405 ENSSTOP00000001029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]