SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001033 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001033
Domain Number 1 Region: 200-316
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 2.75e-23
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000214
Further Details:      
 
Domain Number 2 Region: 98-206
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 1.29e-22
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000145
Further Details:      
 
Domain Number 3 Region: 45-96
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000438
Family TS-N domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001033   Gene: ENSSTOG00000001159   Transcript: ENSSTOT00000001155
Sequence length 324
Comment pep:known_by_projection scaffold:spetri2:JH393456.1:1919398:1929673:1 gene:ENSSTOG00000001159 transcript:ENSSTOT00000001155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLRSLRFFPVRCLGADAGSLRLQSPQPRHTFHAASWLSASSSSKELLMKLRQKTGYSF
VNCKKALETCGGDLKKAEIWLHKQAQKEGWSKATKLSGRKTKEGLIGLLQEGNTTVLVEV
NCETDFVSRNLKFQQLVQQVALGTMLHCRSLKDQLSTYSKGFLNSSELSGLPAGPDRERS
LKDQLALAIGKLGENMTLKRAAWVKVPSGFYVGSYVHGAMHSPSLHNLVLGKYGALVICE
TPEQKANLEDLGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYVQ
PHGVSVVDFVRFECGELEEAIEAE
Download sequence
Identical sequences ENSSTOP00000001033 ENSSTOP00000001033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]