SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001077 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001077
Domain Number 1 Region: 388-689
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.44e-72
Family Protein kinases, catalytic subunit 0.000000517
Further Details:      
 
Domain Number 2 Region: 226-347
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-35
Family Kringle modules 0.00026
Further Details:      
 
Domain Number 3 Region: 13-100
Classification Level Classification E-value
Superfamily Immunoglobulin 9.28e-22
Family I set domains 0.028
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000001077
Domain Number - Region: 118-205
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0392
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001077   Gene: ENSSTOG00000001203   Transcript: ENSSTOT00000001204
Sequence length 887
Comment pep:known_by_projection scaffold:spetri2:JH393606.1:631054:656578:-1 gene:ENSSTOG00000001203 transcript:ENSSTOT00000001204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEY
GSRLRIQDLDTTDTGYYQCVATNGVKTITATGVLYVRLGPTHSPNHNFQDDYQEDGFCQP
YRGIACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVF
PLCDARSRAPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQLPKCEALPLPESPD
AANCMRIGIPAERLGRYHQCYNGSGSDYRGTASTTKSGHQCQPWALQHPHSHHLSSTDFP
ELGGGHAYCRNPGGQMEGPWCFTQNKNVRMELCDVPSCSPRHSSKMGILYILVPSIAIPL
VIACLFFLVCMCRNKQKASASTPQRRQLMASPSQDVEMPLINQHKQAKLKEISLSSVRFM
EELGEDRFGKVYKGHLFGPSQGEQTQVVAIKTLKDKAEGTLREEFRHEALLRARLQHPNI
VCLLGMVTKDQPLSMVFSYCSHGDLHEFLVMRSPHSDVGSTDDDRTVQSALEPPDFVHMV
AQVAAGMEYLSGHHVVHKDLATRNVLVYDKLSVKISDLGLFREVYSADYYKLMGSSPLPI
RWMSPEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDD
CPAWVYALMIECWNEFPSRRPRFKDIHSRLRAWGNLSTYNSSAQTSGASNTTQTSSLSTS
PVSNVSNARYLGPKQKAQPFPQPQFIPMKGQIRPMVPPPQLYIPVNGYQPVPAYGAYLPS
FYPVQIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSVADRAALLSEGTEE
AQNIPEDVVQSPVQEAEEEEDGSVPETELLGDNDTLQVDEAQVQLEA
Download sequence
Identical sequences ENSSTOP00000001077 ENSSTOP00000001077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]