SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001111 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001111
Domain Number 1 Region: 956-1169
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-106
Family Thrombospondin C-terminal domain 0.00000000129
Further Details:      
 
Domain Number 2 Region: 29-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.02e-38
Family Laminin G-like module 0.00000000793
Further Details:      
 
Domain Number 3 Region: 834-954
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.75e-37
Family TSP type-3 repeat 0.000000144
Further Details:      
 
Domain Number 4 Region: 490-547
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.35e-17
Family TSP-1 type 1 repeat 0.0000149
Further Details:      
 
Domain Number 5 Region: 436-485
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 5.23e-16
Family TSP-1 type 1 repeat 0.0000342
Further Details:      
 
Domain Number 6 Region: 764-835
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000196
Family TSP type-3 repeat 0.00021
Further Details:      
 
Domain Number 7 Region: 318-375
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000335
Family VWC domain 0.0077
Further Details:      
 
Domain Number 8 Region: 692-776
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000719
Family TSP type-3 repeat 0.00014
Further Details:      
 
Domain Number 9 Region: 380-429
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000419
Family TSP-1 type 1 repeat 0.00073
Further Details:      
 
Domain Number 10 Region: 548-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000475
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001111   Gene: ENSSTOG00000001238   Transcript: ENSSTOT00000001239
Sequence length 1172
Comment pep:known_by_projection scaffold:spetri2:JH393281.1:3065242:3079122:1 gene:ENSSTOG00000001238 transcript:ENSSTOT00000001239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLAWGFIVLFLLHVCDTNRIPESGGDNSVFDIFELTGAARRGSGRRLVKGPDPSSPAFR
IENANLIPPVPDDKFQDLVDAVRADKGFLLLASLRQMKKTRGTLLAVERKDHSGQIFSVV
SNGKAGTLDLSLSVQGNQQIVSVEEALLATGQWKTITLFVQEDRAQLYIDCEKMENAELD
VPIQNIFTRDLANIARLRIAKGDVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSAATNVL
LTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIH
KVTEENKVLANELRKPPLCYHNGIQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCS
NATVPDGECCPRCWPSDSADDGWSPWSEWTSCSATCGNGIQQRGRSCDSLNNRCEGSSVQ
TRTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEAR
ETKACRKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPMPQFGGKDCIGDVTENQ
VCNKQDCPIDGCLSNPCFAGAKCTSYPDGSWKCGACPPGYSGNGIQCKDVDECKEVPDAC
FNHNGEHRCKNTDPGYNCLPCPPRFTGSQPFGRGVEHAMANKQVCKPRNPCTDGTHDCNK
NAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNEDLVCVANATYHCKKDNCP
NLPNSGQEDYDKDGVGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPY
NHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQKDTDMDGVGDQCDNCPLE
HNPDQLDSDSDHIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDD
NDGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDVDDICPENVDISETDFRR
FQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGFDKFNAVDFSGTFFINTERD
DDYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNA
LWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVIMYEGKKIMADSGPIY
DKTYAGGRLGLFVFSQEMVFFSDLKYECRGRN
Download sequence
Identical sequences ENSSTOP00000001111 ENSSTOP00000001111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]