SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001163 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001163
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.72e-45
Family Calponin-homology domain, CH-domain 0.0000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001163   Gene: ENSSTOG00000001300   Transcript: ENSSTOT00000001299
Sequence length 199
Comment pep:known_by_projection scaffold:spetri2:JH393644.1:813155:826433:1 gene:ENSSTOG00000001300 transcript:ENSSTOT00000001299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRTHFQKWLMDGT
VLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAEIYGVRTTDIFQTVDLWEGK
DMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGS
NKGASQAGMTGYGMPRQIM
Download sequence
Identical sequences A0A091DF67 A0A287BQL0 I3LYC3
ENSSTOP00000001163 ENSDNOP00000027502 ENSSTOP00000001163 XP_004483460.2.11602 XP_005341040.1.77405 XP_015334018.1.40921 XP_019063883.1.5607 XP_020926048.1.46622 XP_020926049.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]