SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001205 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001205
Domain Number 1 Region: 262-362
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.35e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 1-69
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000837
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 
Domain Number 3 Region: 83-137,165-180
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000006
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001205   Gene: ENSSTOG00000001344   Transcript: ENSSTOT00000001345
Sequence length 524
Comment pep:known_by_projection scaffold:spetri2:JH393358.1:182075:215050:-1 gene:ENSSTOG00000001344 transcript:ENSSTOT00000001345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REAHSQTEKRRRDKMNNLIEELSAMIPQCNPVARKLDKLTVLRMAVQHLKSVKGMTNSYL
GDHYRPSFIQDNELRHLILKTAEGFLFVVGCERGKILFVSKSVSKVLNYDQASLTGQSLF
DFLHPKDVAKVKEQLSSSDISPREKLIDAKTGLPVHSNCHAGRTRVYSGSRRSFFCRIKS
CKISVKEEHGCLPNLKKKDHRKFCTIHCTGYLRSWPPDMVGMEEERDNKKDNSHFTCLVA
IGRLHPYIVPQNSGEIKVKPTEFITRFAMNGKFVYVDQRATAILGYLPQELLGTSCYEYF
HQDDHSNLTDKHKAVLQSKEKIFTDSYKFRVKDGSFVTLKSQWFSFTNPWTRELEYIVSV
NTLVLGHSETRGASLFHCSSQSSEESPKQSCIHVPGMSTGTVLGAGSIGTDIANEVLNLQ
RIRSSSADPGTGPVGLFKSGSLSADCQGMSNQELFSLSPSETGELETTRQSQSTHEPLLS
DSAQLDFDALCDNEDTAMAAFMNYLEAEGGLGDPGDFSDIQWTL
Download sequence
Identical sequences ENSSTOP00000001205 ENSSTOP00000001205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]