SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001324 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001324
Domain Number 1 Region: 13-77
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000115
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 2 Region: 120-201
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000423
Family Calmodulin-like 0.079
Further Details:      
 
Domain Number 3 Region: 207-248
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000324
Family VWC domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001324   Gene: ENSSTOG00000001471   Transcript: ENSSTOT00000001480
Sequence length 287
Comment pep:known_by_projection scaffold:spetri2:JH393346.1:7134933:7153068:-1 gene:ENSSTOG00000001471 transcript:ENSSTOT00000001480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNGKTYLNHCELHR
DACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQANRDELRRRIIQWLEAEIIPDGWFSK
GSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYADQENNKLLRGLCVDAL
IELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDERYADGAETEVDCNRCVCACGNWV
CTAMTCDGKNQKGTQTQTEEEVTRYVQELQKHQETAEKTKKVSTKEI
Download sequence
Identical sequences ENSSTOP00000001324 ENSSTOP00000001324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]