SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001423 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001423
Domain Number 1 Region: 22-355
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.46e-111
Family Transferrin 0.000000296
Further Details:      
 
Domain Number 2 Region: 365-704
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.16e-110
Family Transferrin 0.000000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001423   Gene: ENSSTOG00000001590   Transcript: ENSSTOT00000001591
Sequence length 737
Comment pep:known_by_projection scaffold:spetri2:JH393643.1:853112:875274:1 gene:ENSSTOG00000001590 transcript:ENSSTOT00000001591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGWSVALWLLLALRTVLGQVEVQWCTTSDPEQQKCSDMSKAFQEAGIQPSLLCIQGISA
DHCVQLITAQEADAITLDGGAIYEAGKEYGLKPVVGEVYDQEVGTSYYAVAVVRRNFNVT
INTLKGVKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGETR
YSESLCRLCRGDTSGEGVCDKSPLERYYDYSGAFRCVAEKAGDVAFVKHSTVLENTDGKT
LPSWGQTMLSKDFELLCRDGSRADVTEWRRCHLARVPAHAVVVRADMDGGLIFRLLNEGQ
RLFSHEGSSFQMFSSEAYGQKNLLFKDSTTELVPIATQTYEAWLGREYLHAMKGLLCDPN
RMPHYLRWCVLSTPEIQKCGDMAVAFSRQRLKPEIQCVSAQSPQHCMEQIQAGNIDAVTL
RGEDIYTSGKVYGLVPAAGELYSEADRSSSYFVVAVVRRDSSYAFTLDELRGKRSCHSGF
GSPAGWDVPVGALIQRGFIRPQHCDILTAVSEFFNASCVPVNNPKNYPSSLCALCVGDEQ
GRNKCVGNSQERYYGDSGAFRCLVENAGDVAFVKHTTVFDNTNGHNSEPWAAALKWQEYE
LLCPNGARAEANQYEACNLAQIPSHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNTNGFKM
FDSSKYHGQDLLFKDATIRAVPVGEKTSYLDWLGADYVAALEGMLSQQCSGTAAAQPPGP
QLPLLLPLFTGLLLHAL
Download sequence
Identical sequences I3LYV3
ENSSTOP00000001423 ENSSTOP00000001423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]