SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001599 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001599
Domain Number 1 Region: 47-170
Classification Level Classification E-value
Superfamily MTH938-like 2.09e-40
Family MTH938-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001599   Gene: ENSSTOG00000001799   Transcript: ENSSTOT00000001793
Sequence length 184
Comment pep:known_by_projection scaffold:spetri2:JH393339.1:747021:748010:1 gene:ENSSTOG00000001799 transcript:ENSSTOT00000001793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAFSLRYLYRARPVPRFLHVALQWFPQRGHRLSLADDELYQRTHISLLQREFPHIMYI
DSYNSRGFTINGNRVLGPCALLPHSVVQWNVGSHQNITEESFSLFWLLEPRIEIVVVGTG
NRTERLHSKVLQAIRQRGIALEVQDTPSACATFNFLCHEGRMTGAVLIPPPGETSLTYMS
QDAE
Download sequence
Identical sequences I3LZ82
ENSSTOP00000001599 ENSSTOP00000001599 XP_005326952.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]