SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001706 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001706
Domain Number 1 Region: 29-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000858
Family VWC domain 0.0000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001706   Gene: ENSSTOG00000001893   Transcript: ENSSTOT00000001913
Sequence length 1488
Comment pep:known_by_projection scaffold:spetri2:JH393322.1:5862367:5892618:-1 gene:ENSSTOG00000001893 transcript:ENSSTOT00000001913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRLGAPQTLVLLTLLVAAVLRCQGQDLQEAGSCLQDGQRYNDKDVWKPEPCRICVCDTG
TVLCDDIICEDVKDCLSPEIPFGECCPICPADLATTSGRKPGPKGQKGEPGDIKDITGPR
GPPGPQGPAGEQGPRGDRGDKGEKGPPGPRGRDGEPGTPGNPGPPGPPGPPGPSGLGGNF
AAQMAGGFDEKAGGAQMGVMQGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPM
GPRGPPGLPGKPGDDGEAGKPGKSGERGLPGPQGARGFPGTPGLPGVKGHRGYPGLDGAK
GEAGAPGVKGESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPV
GPAGGPGFPGAPGAKGEAGPTGARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAK
GSAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGELGPAGPQ
GAPGPAGEEGKRGARGEPGGAGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLA
GPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGIPGEDGRPGPPGPQGARGQP
GVMGFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAP
GPSGFQGLPGPPGPPGEGGKPGEQGIPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGAR
GLPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGISGPKGDRGDVGEKGPEGAP
GKDGVRGMTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPP
GADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFP
GAAGRVGPPGSNGNPGPPGPPGPSGKDGPKGVRGDIGPPGRAGDPGLQGPAGPPGEKGEP
GDDGPAGVDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPP
GPVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPA
GPTGKQGDRGEAGAQGPMGPSGPAGARGIPGPQGPRGDKGESGEPGERGLKGHRGFTGLQ
GLPGPPGPSGDQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPPGPRGRSGETGPA
GPPGNPGPPGPPGPPGPGIDMSAFAGLGQREKGPDPLQYMRADQAAGTLRQHDAEVDATL
KSLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMET
GETCVYPNPANVPKKNWWSSKSKDKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLR
LLSTEGSQNITYHCKNSIAYLDETAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCT
KHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCFL
Download sequence
Identical sequences ENSSTOP00000001706 XP_021581794.1.77405 ENSSTOP00000001706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]