SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001753 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001753
Domain Number 1 Region: 5-416
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 4.48e-170
Family Phosphoglycerate kinase 0.000000000000372
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001753   Gene: ENSSTOG00000001972   Transcript: ENSSTOT00000001968
Sequence length 417
Comment pep:novel scaffold:spetri2:JH393357.1:286401:309622:1 gene:ENSSTOG00000001972 transcript:ENSSTOT00000001968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSNKLTLDKLDVKGKRVIMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVL
MSHLGRPDGVPMPDKYSLEPVAAELKSLLGKDVLFLKDCVGPEVEKACANPPAGSVILLE
NLRFHVEEEGKGKDASGNKVKAEPAKVEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGM
AFTFLKVLNNMEIGTSLFDEEGSKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQ
ATVASGIPDGWMGLDCGPESSKKYAEAVGRAKQIVWNGPVGVFEWEAFARGTKALMDEVV
KATARGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNV
Download sequence
Identical sequences I3LZI7
ENSSTOP00000001753 XP_005328868.1.77405 ENSSTOP00000001753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]