SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001859 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001859
Domain Number 1 Region: 135-320
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.73e-50
Family DNA repair glycosylase, 2 C-terminal domains 0.0000000301
Further Details:      
 
Domain Number 2 Region: 10-133
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 6.75e-37
Family DNA repair glycosylase, N-terminal domain 0.000000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001859   Gene: ENSSTOG00000002087   Transcript: ENSSTOT00000002087
Sequence length 344
Comment pep:known_by_projection scaffold:spetri2:JH393412.1:3369461:3418526:-1 gene:ENSSTOG00000002087 transcript:ENSSTOT00000002087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVARSLLGIMKHRTLSSSPALWASIPCPRSELRLDLVLTSGQSFRWKEQSPAHWSGVLAD
QVWTLTQTEELLYCTVYRGDKGWVGKPTPEELETVHKYFQLDVSLAQLYSHWSSVDSHFQ
KMAQKFQGVRLLRLDPIECLFSFICSSNNNITRITGMVERLCQAFGPRLIQLDDVTYHGF
PTLQALAGSEVEACLRKLGLGYRAQYVSASARAILEEQGGLAWLQQLREAPYEEAHKALC
TLPGVGTKVADCICLMALEKPQAVPVDVHVWQIAQRDYSWHPTTSQAKGPSPQANKELGN
FFRRLWGPYAGWAQAVLFSADLHQPHRSQEPPAKRKKRSKGPEV
Download sequence
Identical sequences I3LZR6
XP_005333883.1.77405 ENSSTOP00000001859 ENSSTOP00000001859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]