SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001999 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001999
Domain Number 1 Region: 87-224
Classification Level Classification E-value
Superfamily FKBP-like 1.36e-37
Family FKBP immunophilin/proline isomerase 0.000000929
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000001999
Domain Number - Region: 26-89
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00345
Family Mevalonate 5-diphosphate decarboxylase 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001999   Gene: ENSSTOG00000002249   Transcript: ENSSTOT00000002240
Sequence length 225
Comment pep:known_by_projection scaffold:spetri2:JH393393.1:4146787:4161778:1 gene:ENSSTOG00000002249 transcript:ENSSTOT00000002240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMAAAVPQRAWTVEQLRSEQLPKKDIIKFLQDHGSDSFLAEHKLLGNIKNVAKTANKDHL
VTAYNHLFESKRFKGTESVSKVSEQVKNVKLNEDKPKETKSEETMDEGPPKYTKSVLKKG
DKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSSKKKKNAKPLSFKVGVGKVIRGWDEAL
LTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLIFEVELVDID
Download sequence
Identical sequences ENSSTOP00000001999 ENSSTOP00000001999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]