SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000002018 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000002018
Domain Number 1 Region: 8-115
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0000000719
Family Cgl1923-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000002018   Gene: ENSSTOG00000002261   Transcript: ENSSTOT00000002260
Sequence length 254
Comment pep:known_by_projection scaffold:spetri2:JH393436.1:2330458:2344630:1 gene:ENSSTOG00000002261 transcript:ENSSTOT00000002260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLLKMSFFQPAVSVGNVGQLAIDLIISTLNMRKIGYFYTDCLVPIVGNNPYATEEDNSTE
LSTNAEVYSLPSKKLVALQLRSIFIKYKSKSFCEKLLSWVQSSGCAKVIVLSSTHSYQRN
DLQLRSTPFRYLLTPSVQKNVQSKIQSLNWQEMEKSPCIPQMDDSEFCVRVPGGGITKTL
YDESCSKEIQMVVLLKFVSEGDNIPDALGLVEYLNEWLQIIKPCSVNPATSALPWKIPSS
WRLLFGSGLPPALF
Download sequence
Identical sequences ENSSTOP00000002018 ENSSTOP00000002018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]